← Back to search

9rlu

Leishmania major N-myristoyltransferase in complex with azetidinopyrimidine inhibitor IMP-819

Method: X-RAY DIFFRACTION D_max: 78.4 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9rlu
deposition_date	2025-06-17
last_revision	2026-05-27
title	Leishmania major N-myristoyltransferase in complex with azetidinopyrimidine inhibitor IMP-819
keywords	myristoylation, azetidinopyrimidine, Leishmania, inhibitor, TRANSFERASE; TRANSFERASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	23.12 Å
rg_electron	22.07 Å
i0	73507400.00
molecular_weight	45451.0 kDa
excluded_volume	44263 Å³
envelope_volume	71179 Å³
shell_volume	26537 Å³
envelope_diameter	78.5 Å
shell_rg	29.55 Å
envelope_rg	22.45 Å
shape_rg	22.04 Å
total_rg	22.79 Å
total_atoms	3446
n_residues	411
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	78.4 Å
rg_real	23.01 Å
rg_real_error	0.49 Å
i0_real	7.3510e+07
i0_real_error	9.7030e+05
rg_reciprocal	23.04 Å
i0_reciprocal	73510000.0000
total_estimate	0.8776
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	77.2 Å
skewness	0.216
kurtosis	-0.403
angular_range	— – 0.3450 Å⁻¹
current_alpha	0.0000
highest_alpha	11540000.0000
n_real_points	66
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.803; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.997

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Glycylpeptide N-tetradecanoyltransferase
formula_weight	48195.8 kDa
ec_number	2.3.1.97
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	4316

NPSNSDAAHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML

Source

organism	Leishmania major
ncbi_taxonomy_id	5664
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	TETRADECANOYL-COA
formula_weight	977.9 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	1-[5-chloranyl-2-[2-(dimethylamino)ethylamino]pyrimidin-4-yl]-~{N}-[(5-methylpyrazin-2-yl)methyl]azetidine-3-carboxamide
formula_weight	404.9 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	1

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	673

▶

6. Citations (1)

▶

length_a	47.408 Å
length_b	90.794 Å
length_c	52.945 Å
angle_alpha	90.00 °
angle_beta	111.72 °
angle_gamma	90.00 °
z_pdb	2

space_group	P 1 21 1
int_tables_number	4
crystal_system	—

resolution	1.300 Å
resolution_low	49.186 Å
r_factor	—
r_work	0.1619
r_free	0.1923

fit	/app/data/saxs_computation/rl/9rlu/9rlu.fit
pddf	/app/data/pr_computation/rl/9rlu/9rlu.pr.out
profile	/app/data/saxs_computation/rl/9rlu/9rlu.dat