← Back to search

9s0i

Intermediate-state of CBD of TtCarH mutant - H132A after 10 ms illumination (SSX, DLS)

Method: X-RAY DIFFRACTION D_max: 92.7 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9s0i
deposition_date	2025-07-16
title	Intermediate-state of CBD of TtCarH mutant - H132A after 10 ms illumination (SSX, DLS)
keywords	;SFX, Room temperature, serial crystallography, CarH, photoreceptor, vitamin B12, cobalamin, coenzyme B12, time-resolved crystallography, DNA BINDING PROTEIN ;; DNA BINDING PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	29.43 Å
rg_electron	28.30 Å
i0	122422000.00
molecular_weight	90048.0 kDa
excluded_volume	113920 Å³
envelope_volume	134460 Å³
shell_volume	39049 Å³
envelope_diameter	98.5 Å
shell_rg	36.13 Å
envelope_rg	28.27 Å
shape_rg	28.31 Å
total_rg	29.04 Å
total_atoms	6357
n_residues	785
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	92.7 Å
rg_real	29.37 Å
rg_real_error	0.63 Å
i0_real	1.2240e+08
i0_real_error	1.9400e+06
rg_reciprocal	29.40 Å
i0_reciprocal	122400000.0000
total_estimate	0.8951
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	34.3 Å
skewness	0.300
kurtosis	-0.416
angular_range	— – 0.2700 Å⁻¹
current_alpha	0.0000
highest_alpha	50970000.0000
n_real_points	55
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.920; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.873

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Probable transcriptional regulator
formula_weight	23192.7 kDa
src_method	man
entity_count	4

Polymer

type	polypeptide(L)
strand_id	A,B,C,D
atom_count	12906

VRPEDLGTGLLEALLRGDLAGAEALFRRGLRFWGPEGVLEHLLLPVLREVGEAWARGEIGVAEEHLASTFLRARLQELLDLAGFPPGPPVLVTTPPGERHEIGAMLAAYHLRRKGVPALYLGPDTPLPDLRALARRLGAGAVVLSAVLSEPLRALPDGALKDLAPRVFLGGQGAGPEEARRLGAEYMEDLKGLAEALWLPRGPEKEAIGHHHHHH

Source

organism	Thermus thermophilus
ncbi_taxonomy_id	274
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	COBALAMIN
formula_weight	1330.4 kDa
src_method	syn
entity_count	4

Entity 3 non-polymer

description	5'-DEOXYADENOSINE
formula_weight	251.2 kDa
src_method	syn
entity_count	4

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	194

▶

6. Citations (1)

▶

length_a	64.508 Å
length_b	71.433 Å
length_c	206.704 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	16

space_group	P 21 21 21
int_tables_number	19
crystal_system	—

resolution	2.200 Å
resolution_low	67.510 Å
r_factor	0.2025
r_work	0.2001
r_free	0.2496

fit	/app/data/saxs_computation/s0/9s0i/9s0i.fit
pddf	/app/data/pr_computation/s0/9s0i/9s0i.pr.out
profile	/app/data/saxs_computation/s0/9s0i/9s0i.dat

Intermediate-state of CBD of TtCarH mutant - H132A after 10 ms illumination (SSX, DLS)

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction