← Back to search

9s4x

AcuB from Geobacillus stearothermophilus with ADP

Method: X-RAY DIFFRACTION D_max: 80.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9s4x
deposition_date	2025-07-28
title	AcuB from Geobacillus stearothermophilus with ADP
keywords	Repressor, acetoin utilization operon, DNA BINDING PROTEIN; DNA BINDING PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	24.53 Å
rg_electron	23.71 Å
i0	36826200.00
molecular_weight	46498.0 kDa
excluded_volume	58255 Å³
envelope_volume	71317 Å³
shell_volume	25363 Å³
envelope_diameter	81.3 Å
shell_rg	30.74 Å
envelope_rg	24.08 Å
shape_rg	23.72 Å
total_rg	24.50 Å
total_atoms	6603
n_residues	401
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	80.3 Å
rg_real	24.55 Å
rg_real_error	0.53 Å
i0_real	3.6830e+07
i0_real_error	5.1680e+05
rg_reciprocal	24.55 Å
i0_reciprocal	36830000.0000
total_estimate	0.8852
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	25.5 Å
skewness	0.384
kurtosis	-0.332
angular_range	— – 0.3250 Å⁻¹
current_alpha	0.0000
highest_alpha	11270000.0000
n_real_points	64
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.873; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.964; Smooth: 0.921

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	AcuB from Geobacillus stearothermophilus
formula_weight	24765.6 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	6631

ALVEQAMKAPVITLRATNTIAEALQLLRHHRIRHLPVVDGEGRLLGLVTSQDLRDASPSIFHLHEHLEDLQKPVSTIMKTDLIVGHPLDFVEEVAALFYEHRIGCLPIVNHGKLVGIITQTDLLRTFIELTGVHQPGSQIEIKVPNEAGMLSKAAAIISERHVNIASVLVYPAPDPNEKILVFRVQTMNPLPLIRDLQNAGYHVLWPNLPGVTSGSSHHHHHH

Source

organism	Bacillus subtilis subsp. subtilis str. 168
ncbi_taxonomy_id	224308
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	ADENOSINE-5'-DIPHOSPHATE
formula_weight	427.2 kDa
src_method	syn
entity_count	4

Entity 3 non-polymer

description	DI(HYDROXYETHYL)ETHER
formula_weight	106.1 kDa
src_method	syn
entity_count	2

Entity 4 non-polymer

description	CHLORIDE ION
formula_weight	35.5 kDa
src_method	syn
entity_count	2

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	10

▶

6. Citations (1)

▶

length_a	52.486 Å
length_b	96.492 Å
length_c	101.088 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 21 21 21
int_tables_number	19
crystal_system	—

resolution	2.760 Å
resolution_low	48.293 Å
r_factor	—
r_work	0.1828
r_free	0.2489

fit	/app/data/saxs_computation/s4/9s4x/9s4x.fit
pddf	/app/data/pr_computation/s4/9s4x/9s4x.pr.out
profile	/app/data/saxs_computation/s4/9s4x/9s4x.dat