SAXSdb — 9skh

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

2,4-diacetylphloroglucinol biosynthesis protein

Chromobacterium sphagni

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	2,4-diacetylphloroglucinol biosynthesis protein × 4 （A0A1S1X4L8） 2,4-diacetylphloroglucinol biosynthesis protein × 4 （A0A1S1X4K0） ZINC ION × 4 water × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1S1X4Q2_9NEIS
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–360； UniProt 1–360 Author chain B； PDBConstruct 1–360； UniProt 1–360 Author chain C； PDBConstruct 1–360； UniProt 1–360 Author chain D； PDBConstruct 1–360； UniProt 1–360

2,4-diacetylphloroglucinol biosynthesis protein

Chromobacterium sphagni

UniProt A0A1S1X4L8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	2,4-diacetylphloroglucinol biosynthesis protein × 4 （A0A1S1X4Q2） 2,4-diacetylphloroglucinol biosynthesis protein × 4 （A0A1S1X4K0） ZINC ION × 4 water × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1S1X4L8_9NEIS
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–145； UniProt 1–145 Author chain F； PDBConstruct 1–145； UniProt 1–145 Author chain G； PDBConstruct 1–145； UniProt 1–145 Author chain H； PDBConstruct 1–145； UniProt 1–145

2,4-diacetylphloroglucinol biosynthesis protein

Chromobacterium sphagni

UniProt A0A1S1X4K0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	2,4-diacetylphloroglucinol biosynthesis protein × 4 （A0A1S1X4Q2） 2,4-diacetylphloroglucinol biosynthesis protein × 4 （A0A1S1X4L8） ZINC ION × 4 water × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1S1X4K0_9NEIS
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–398； UniProt 1–398 Author chain J； PDBConstruct 1–398； UniProt 1–398 Author chain K； PDBConstruct 1–398； UniProt 1–398 Author chain L； PDBConstruct 1–398； UniProt 1–398

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9skh
Deposition date deposition_date	2025-09-02
Structure title title	Biocatalytic Regioselective C-Formylation of Resorcinol Derivatives
Keywords keywords	C-formylation of phenolic substrates, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9skh__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9skh__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9skh__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.01 Å
Rg (electron density)	44.50 Å
Total Rg	44.90 Å
Atom count	53801
Residues	3595
Excluded volume	481350 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9skh__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	2,4-diacetylphloroglucinol biosynthesis protein
Molecular weight formula_weight	38165.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	54119

MKKIGIVSYGSSIPTCRLKINDVIDVWKNTDLDLVKNHLGVCERAVLQPDEDVITLGVQAAQRALEHAGSPTLDALHLGTCTNPYDSRSSAAIILEMLGQGYDMYCADVQFSGKSGTSALQISQALVASGMAGHALAIAADAINRHTAPGDLTESYAGAGAAAMLVGSENLIAEIDGTFSCAADIADNIRPQGERYIRSGMGLGSDKNSIGLEDQTRRAAEGLMGKLKTSASDFDYVVFQQNVVSTPRSLGKLLGFTAEQLEPALFADTIGDTGAASPLLGLIQVLDQAKPGDRILLVSYGFGAGSDAIALTVTDNIAAHQQRATTLKTQLGQKQYVDYGTAIKYEFKYLRPDYALTAYL

Source Source

Source organism organism	Chromobacterium sphagni
NCBI taxonomy ID ncbi_taxonomy_id	1903179
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	2,4-diacetylphloroglucinol biosynthesis protein
Molecular weight formula_weight	16517.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

MSLYPEHIHRMTTASMLREWREHGGKYRLEGSRCQECEAIFFPRRSVCGACNSLKIEPYGCKRHGTIVALSRAENPILAGMGYGEAVPRHMVMLRLDDGIGIASEVVDILDPAKLKIGARVKMVIRKHVRESNLAWQYAYKFVLE

Source Source

Source organism organism	Chromobacterium sphagni
NCBI taxonomy ID ncbi_taxonomy_id	1903179
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	2,4-diacetylphloroglucinol biosynthesis protein
Molecular weight formula_weight	42736.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K,L

MSARRVAIVSAAYTPKPGSSRVRQTFKEMIVESAYKAIRDAKMHPREIQGVAYGYHGEGISEYGGLGPTISDALGISPAPTFITSSNCTSSSVSFQMGHQMVASGEYDIVLCGGFEKMTDHFNYAEYIGSSTECEYDYFLGISHTDAFALATSEYFHKYGYAGREADVLAHFGRQMRIYAQNTPSATRYGQAIPSLEALKASEAHGSMLAWGEASGCAILVAEHLAHKYTDKPVFIKGCAYTGVSHYFGTRYHNPTLQYPGLPQDVGMALSANSIACAEMAYKKAGITAKDIDVAQVYDLLGAGLIQMESMGICQPGQAGHFVMEGGIALDGQVPLNTDGGNIGRGHASGCDGILHITELFRQLRGEADNQVKNARIAVSQNLGGYAAHNSVIVLTNE

Source Source

Source organism organism	Chromobacterium sphagni
NCBI taxonomy ID ncbi_taxonomy_id	1903179
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	318

▶

Unit-cell length a length_a	94.470 Å
Unit-cell length b length_b	185.447 Å
Unit-cell length c length_c	120.680 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	103.21 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.600 Å
Low-resolution limit resolution_low	91.970 Å
R factor r_factor	0.1929
R_work r_work	0.1903
R_free r_free	0.2405

Biocatalytic Regioselective C-Formylation of Resorcinol Derivatives

1. Protein Identity and Related Structures Protein Identity & Related Structures

2,4-diacetylphloroglucinol biosynthesis protein

State in the Current Structure

Other States of the Same Protein in the Database

2,4-diacetylphloroglucinol biosynthesis protein

State in the Current Structure

Other States of the Same Protein in the Database

2,4-diacetylphloroglucinol biosynthesis protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9skh__assembly_1__model_1

9skh__assembly_1__model_1 | I(q)

9skh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Biocatalytic Regioselective C-Formylation of Resorcinol Derivatives

1. Protein Identity and Related Structures Protein Identity & Related Structures

2,4-diacetylphloroglucinol biosynthesis protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2,4-diacetylphloroglucinol biosynthesis protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2,4-diacetylphloroglucinol biosynthesis protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9skh__assembly_1__model_1

9skh__assembly_1__model_1 | I(q)

9skh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)