SAXSdb — 9teb

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Beta-lactamase

Nocardia cyriacigeorgica

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	(2S,5R)-1-formyl-5-[(sulfooxy)amino]piperidine-2-carboxamide × 1 CITRATE ANION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5R8NCK8_9NOCA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–264； UniProt 34–296

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9teb
Deposition date deposition_date	2025-11-25
Structure title title	Crystal structure of Nocardia cyriacigeorgica, class A beta-lactamase, NCY-1 bound to Avibactam
Keywords keywords	beta-lactamase, avibactam, Nocardia, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9teb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9teb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9teb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.52 Å
Rg (electron density)	17.37 Å
Total Rg	18.23 Å
Atom count	3868
Residues	259
Excluded volume	34503 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9teb__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Beta-lactamase
Molecular weight formula_weight	27942.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4202

GSAVADPRFAALETTAGARLGVFAVNTGSERTVAHRADERFPMASTFKGLACGALLREHPLSTGYFDQVIHYSAEELVDYSPVTETRVESGMTVAELCHAAITASDNTAGNQLLKLLGGPQGFTAFLRSLGDDTSRLDRWETELNTAIPGDERDTTTPAALAADYRALVVGDVLGEPERAQLTAWLVANTTGDTRIRAGLPEDWTVGDKTGSPAYGSALDVAVTWPSGRAPIVIAVLSTKSEQDAEPDNRLVADATRTVVDVLG

Source Source

Source organism organism	Nocardia cyriacigeorgica
NCBI taxonomy ID ncbi_taxonomy_id	135487
Host organism host_organism	Escherichia coli BL21

Entity 2 Entity 2 non-polymer

Description description	(2S,5R)-1-formyl-5-[(sulfooxy)amino]piperidine-2-carboxamide
Molecular weight formula_weight	267.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	CITRATE ANION
Molecular weight formula_weight	189.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	221

▶

Unit-cell length a length_a	54.590 Å
Unit-cell length b length_b	54.590 Å
Unit-cell length c length_c	133.210 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	trigonal

Resolution resolution	1.300 Å
Low-resolution limit resolution_low	44.550 Å
R factor r_factor	0.1570
R_work r_work	0.1561
R_free r_free	0.1752

Crystal structure of Nocardia cyriacigeorgica, class A beta-lactamase, NCY-1 bound to Avibactam

1. Protein Identity and Related Structures Protein Identity & Related Structures

Beta-lactamase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9teb__assembly_1__model_1

9teb__assembly_1__model_1 | I(q)

9teb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (2)

Crystal structure of Nocardia cyriacigeorgica, class A beta-lactamase, NCY-1 bound to Avibactam

1. Protein Identity and Related Structures Protein Identity & Related Structures

Beta-lactamase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9teb__assembly_1__model_1

9teb__assembly_1__model_1 | I(q)

9teb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (2)