← Back to search

9tq7

Neuraminidase NA isolated from the H1N1 strain A/Victoria/2570/2019 propagated in eggs

Method: ELECTRON MICROSCOPY D_max: 110.6 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9tq7
deposition_date	2025-12-19
title	Neuraminidase NA isolated from the H1N1 strain A/Victoria/2570/2019 propagated in eggs
keywords	glycosidase, influenza virus, viral release, HYDROLASE; HYDROLASE
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	36.20 Å
rg_electron	35.28 Å
i0	482853000.00
molecular_weight	173250.0 kDa
excluded_volume	214190 Å³
envelope_volume	267870 Å³
shell_volume	60453 Å³
envelope_diameter	115.3 Å
shell_rg	43.90 Å
envelope_rg	34.97 Å
shape_rg	35.27 Å
total_rg	35.86 Å
total_atoms	12156
n_residues	1548
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	110.6 Å
rg_real	36.03 Å
rg_real_error	0.51 Å
i0_real	4.8290e+08
i0_real_error	7.3410e+06
rg_reciprocal	36.14 Å
i0_reciprocal	482900000.0000
total_estimate	0.8915
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	45.2 Å
skewness	0.168
kurtosis	-0.518
angular_range	— – 0.2200 Å⁻¹
current_alpha	0.0001
highest_alpha	209400000.0000
n_real_points	45
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.954; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.991; Smooth: 0.733

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Neuraminidase
formula_weight	51660.9 kDa
ec_number	3.2.1.18
src_method	nat
entity_count	4

Polymer

type	polypeptide(L)
strand_id	A,B,C,D
atom_count	12156

MNPNQKIITIGSICMTIGTANLILQIGNIISIWVSHSIQIGNQSQIETCNKSVITYENNTWVNQTFVNISNTNSAARQSVASVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGTNWLTIGISGPDSGAVAVLKYNGIITDTIKSWRNKILRTQESECACVNGSCFTIMTDGPSDGQASYKIFRIEKGKIIKSVEMKAPNYHYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQMGYICSGVFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRKGFEMIWDPNGWTGTDNKFSKKQDIVGINEWSGYSGSFVQHPELTGLNCIRPCFWVELIRGRPEENTIWTSGSSISFCGVDSDIVGWSWPDGAELPFTIDK

Entity 2 non-polymer

description	2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	221.2 kDa
src_method	syn
entity_count	12

Entity 3 non-polymer

description	CALCIUM ION
formula_weight	40.1 kDa
src_method	syn
entity_count	8

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	3.580 Å
resolution_low	— Å
r_factor	—
r_work	—
r_free	—

resolution	3.58 Å
resolution_method	—
num_particles	204391

fit	/app/data/saxs_computation/tq/9tq7/9tq7.fit
pddf	/app/data/pr_computation/tq/9tq7/9tq7.pr.out
profile	/app/data/saxs_computation/tq/9tq7/9tq7.dat

Neuraminidase NA isolated from the H1N1 strain A/Victoria/2570/2019 propagated in eggs

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

EM 3D

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Entity 2 non-polymer

Entity 3 non-polymer

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)