SAXSdb — 9u6l

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type ATP synthase subunit I

Thermus thermophilus HB8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	V-type ATP synthase, subunit K × 12 （Q5SIT7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5SIT6_THET8
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain N； PDBConstruct 1–313； UniProt 327–639

V-type ATP synthase, subunit K

Thermus thermophilus HB8

UniProt Q5SIT7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	V-type ATP synthase subunit I × 1 （Q5SIT6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5SIT7_THET8
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain O； PDBConstruct 1–74； UniProt 26–99 Author chain P； PDBConstruct 1–74； UniProt 26–99 Author chain Q； PDBConstruct 1–74； UniProt 26–99 Author chain R； PDBConstruct 1–74； UniProt 26–99 Author chain S； PDBConstruct 1–74； UniProt 26–99 Author chain T； PDBConstruct 1–74； UniProt 26–99 Author chain U； PDBConstruct 1–74； UniProt 26–99 Author chain V； PDBConstruct 1–74； UniProt 26–99 Author chain W； PDBConstruct 1–74； UniProt 26–99 Author chain X； PDBConstruct 1–74； UniProt 26–99 Author chain Y； PDBConstruct 1–74； UniProt 26–99 Author chain Z； PDBConstruct 1–74； UniProt 26–99

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9u6l
Deposition date deposition_date	2025-03-23
Last revision last_revision	2025-10-29
Structure title title	Cryo-EM structure of the Vo domain of V/A-ATPase under pmf condition, State3C
Keywords keywords	ATP synthase, V ATPase, V1 ATPase, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9u6l__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9u6l__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9u6l__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	32.55 Å
Rg (electron density)	31.38 Å
Total Rg	32.16 Å
Atom count	8574
Residues	1189
Excluded volume	157630 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9u6l__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	V-type ATP synthase subunit I
Molecular weight formula_weight	34679.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N
Atom count atom_count	8574

AKPFELLVSFLNTPKYGTFDPTPVVPVFFPFWFGMIVGDIGYALLFYLVGRWLSGYVKRNEPLVIDLFALKLKPQVIGKLVHILNWMVFWTVVWGVIYGEFFGTFLEHLGVFGTPEHPGLIPILIHRIDTAKTANLLILLSVAFGVVLVFFGLALRAYLGLKHRHMAHFWEGVGYLGGLVGVLALAASYLGNLQAGWLQGLMYLGFGVFLLAVLMSRIWLMIPEIFTQAGHILSHIRIYAVGAAGGILAGLLTDVGFALAERLGLLGVLLGLLVAGVLHLLILLLTTLGHMLQPIRLLWVEFFTKFGFYEENG

Source Source

Source organism organism	Thermus thermophilus HB8
NCBI taxonomy ID ncbi_taxonomy_id	300852
Host organism host_organism	Thermus thermophilus HB8

Entity 2 Entity 2 polymer

Description description	V-type ATP synthase, subunit K
Molecular weight formula_weight	7309.6 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P,Q,R,S,T,U,V,W,X,Y,Z

SGGLDRGLIAVGMGLAVGLAALGTGVAQARIGAAGVGAIAEDRSNFGTALIFLLLPETLVIFGLLIAFILNGRL

Source Source

Source organism organism	Thermus thermophilus HB8
NCBI taxonomy ID ncbi_taxonomy_id	300852
Host organism host_organism	Thermus thermophilus HB8

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.67 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	29264

Cryo-EM structure of the Vo domain of V/A-ATPase under pmf condition, State3C

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type ATP synthase subunit I

State in the Current Structure

Other States of the Same Protein in the Database

V-type ATP synthase, subunit K

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9u6l__assembly_1__model_1

9u6l__assembly_1__model_1 | I(q)

9u6l__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Cryo-EM structure of the Vo domain of V/A-ATPase under pmf condition, State3C

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type ATP synthase subunit I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type ATP synthase, subunit K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9u6l__assembly_1__model_1

9u6l__assembly_1__model_1 | I(q)

9u6l__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)