← Back to search

9umm

Giraffe KIF5A motor domain crystallized in the presence of 10 mM ADP

Method: X-RAY DIFFRACTION D_max: 84.0 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9umm
deposition_date	2025-04-22
last_revision	2026-04-29
title	Giraffe KIF5A motor domain crystallized in the presence of 10 mM ADP
keywords	Giraffe Kinesin motor KIF, MOTOR PROTEIN; MOTOR PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	27.08 Å
rg_electron	26.20 Å
i0	66681200.00
molecular_weight	63525.0 kDa
excluded_volume	79574 Å³
envelope_volume	98445 Å³
shell_volume	31105 Å³
envelope_diameter	85.2 Å
shell_rg	33.51 Å
envelope_rg	26.15 Å
shape_rg	26.21 Å
total_rg	26.99 Å
total_atoms	4456
n_residues	557
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	84.0 Å
rg_real	26.99 Å
rg_real_error	0.44 Å
i0_real	6.6680e+07
i0_real_error	9.1750e+05
rg_reciprocal	27.02 Å
i0_reciprocal	66680000.0000
total_estimate	0.9094
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	31.3 Å
skewness	0.218
kurtosis	-0.536
angular_range	— – 0.2950 Å⁻¹
current_alpha	0.0000
highest_alpha	10930000.0000
n_real_points	60
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.953; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.958

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (6)

Entity 1 polymer

description	GcKIF5A
formula_weight	37340.4 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	4615

MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQEQVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIVQDIFNHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLAVHEDKNRVPFVKGCTERFVSSPEEILDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTMFICCSPSSFNDAETKSTLMFGQRAKTIKNTASVN

Source

organism	Giraffa camelopardalis
ncbi_taxonomy_id	9894
host_organism	Escherichia coli

Entity 2 non-polymer

description	SULFATE ION
formula_weight	96.1 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	2

Entity 4 non-polymer

description	ACETATE ION
formula_weight	59.0 kDa
src_method	syn
entity_count	5

Entity 5 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	2

Entity 6 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	159

▶

6. Citations (1)

▶

length_a	50.330 Å
length_b	50.310 Å
length_c	78.930 Å
angle_alpha	99.59 °
angle_beta	107.25 °
angle_gamma	94.73 °
z_pdb	2

space_group	P 1
int_tables_number	1
crystal_system	triclinic

resolution	1.950 Å
resolution_low	47.390 Å
r_factor	0.2290
r_work	0.2274
r_free	0.2597

fit	/app/data/saxs_computation/um/9umm/9umm.fit
pddf	/app/data/pr_computation/um/9umm/9umm.pr.out
profile	/app/data/saxs_computation/um/9umm/9umm.dat