9uof

PSI-6 FCPI supercomplex from haptophyte Chrysotila roscoffensis

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

No usable UniProt protein identity is available for this entry.

The relationship tables retain this entry's assembly and composition data, but cross-PDB links for the same protein cannot be established reliably without a unified protein identity.

Assembly Composition of the Current Entry

Assembly	Physical composition	Protein state	蛋白 / DNA / RNA / 其他Polymer	Data consistency
1	Protein heterocomplex	Heteromer	17 / 0 / 0 / 0	Consistent with protein count

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9uof
Deposition date deposition_date	2025-04-25
Structure title title	PSI-6 FCPI supercomplex from haptophyte Chrysotila roscoffensis
Keywords keywords	photosystem I, photosynthesis, chlorophyll, light-harvesting complex, biogenesis, assembly, LHCI, FCPI, coccolithophore, haptophyte; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9uof__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9uof__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9uof__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.37 Å
Rg (electron density)	51.09 Å
Total Rg	51.20 Å
Atom count	35951
Residues	3187
Excluded volume	674640 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9uof__assembly_1__model_1`	17-meric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (30)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1 (psaA)
Molecular weight formula_weight	83368.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	36741

MKIGSKELEAKKVQVVVDKDPVVTSFEKWAQPGHFSRTLAKGPKTTTWIWNLHADAHDFDSQTSSLEDISRKIFSAHFGQLAIIFLWISGMYFHGARFSNYSAWLANPTTIKPSAQVVWPIVGQEILNGDVGGGFAGVQITSGFFQLWRASGITSEIELYWTAIGGLIMSALMVFAGWFHYHKAAPKLEWFQNAESMMNHHLAGLLGLGCLGWAGHQIHVSLPINKLLDAGVSPQEIPLPYELIFNQDLMAQLYPSFKQGLVPFFTLNWSAYSDFLTFKGGLNPITGSLWLSDTAHHHLALSVLFIFAGHMYRTNWGIGHSMKEILEAHKGPLTGEGHKGLYEILTTSWHAQLAINLAMMGSVSIIVAHHMYAMPPYPYIGIDYPTQLSLFTHHMWIGGFCVCGAGAHASIFMVRDYSPVQSYNNLLDRVLRHRDAIISHLNWVCIFLGTHSFGLYIHNDTMRALGRPQDMFSDKAIQLQPIFAQWVQSLHTLAPGNTAPNALATTSYAFGGDVVAVNGKIAMMPIALGTADFLVHHIHAFTIHVTVLILLKGTLFARNSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNCISVVIFHFSWKMQSDVWGTVSAAGKISHVTGGNFANSALTINGWLRDFLWSEASQVIQSYGSALSAYGLIFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHSKLKLAPAIQPRALSITQGRAVGLAHYLLGGIGTTWSFFLARIISVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2 (psaB)
Molecular weight formula_weight	82002.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MATKFPKFSQALAQDPATRRIWYGIATAHDLESHDGMSEENLYQKIFASHFGHLAIIFLWTSGNLFHVAWQGNFQQWVLNPLKVKPIAHAIWDPHFGQSAIKAFTRAGVSYPVNIATSGVYHWWYTIGMRTNNDLYFGALGLLILSTALLFAGWLHLQPKFRPGLAWFKNNESRLNHHLSGLFGVSSLAWSGHLIHVAIPESRGQHIGWDNFTSTLPHPDGLTPFFTGNWGLYAENPDTVKHIFGTSEGAGTAILTFLGGFHPQTQSMWLTDIAHHHLAIAVLFIFAGHMYRTNWGIGHSMKEILDAHVPPKGRLGAGHRGLFETITDSLHMQLGLALASLGVATSLVAQHMYALPPYAFMAKDYVTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPEVNKDNVLARMLQHKEAIISHLSWVSLFLGFHTLGLYIHNDVCVAFGTPEKQILFEPVFAQFIQASSGKAVYGFDVLLSSSTSAATVASSKIWLPGWLEAINSGKNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAMFWMLNTIGWVTFYWHFKHMTIWGGNAAAFNESSTYLMGWLRDYLWLNSSPLINGYNAFGMNAQAVWAWMFLFGHLIWATGFMFLISWRGYWQELIETLVWAHERTPIANLVRWKDKPVALSIVQARLVGLAHFTVGYIFTYAPFVIASTTGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center (psaC)
Molecular weight formula_weight	8836.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSHNVRIYDTCIGCTQCVRACPCDVLEMVPWDGCKAGQIASAPRAEDCIGCKRCETACPTDFLSVRVYLGSETTRSLGLSY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II (psaD)
Molecular weight formula_weight	15936.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSTDILNLQIPSPTFGGSTGGWLRAAETEEKYAITWTSKKEQVFEMPTSGSAIMQKGENLLYLAKKEQCLALGSQLRTGFKIQDYKIYRIFPNSEIQYLHPKDGVFPEKLNEGRIGVGNVDHSIGKNKQPVNVKFSGRNTFD

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV (psaE)
Molecular weight formula_weight	7342.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MVSRGSVVRVMRPESYWFQETGTVATIAKGGDRYPVVVRFDKVNYAGVATNNFAVDELVEVSAPPAK

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III (psaF)
Molecular weight formula_weight	20163.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MKRILSILFLFSVIGNAPLVASADVSGLVPCKDSSVFNRRLDGSVKKLTTRLKNYEEGTPAYLALEQQIAQTKTRFAMYADKGLLCGTDGLPHLIADGRFSHAGEFMIPGVGFLYITGWIGWAGRSYLQFSKKTDKPNESEIIINVPVALSMMSAAFIWPLAAWKELVSGQLLVSADEITVSPR

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit VIII (psaI)
Molecular weight formula_weight	3900.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTASFLPSILTPVVTLIFPGLCFALFFVLIEQEEI

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit IX (psaJ)
Molecular weight formula_weight	4340.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MDKNLLTYLSTAPVLLTAWMTITAGFSIEFLRFFPDAAA

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit XI (psaL)
Molecular weight formula_weight	15045.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSEFVKPYNNDPFVGNLSTPVTTSTATKLYLGNLPIYRKGLSSLRRGLEIGMAHGYFLVGPFYLLGPLRNSESALLIGLFAAFGLILILTLALTIYGLASFQDNETGDALESSSGWQKFTSGFFVGASGGAVVAYVLLANI

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit XII (psaM)
Molecular weight formula_weight	3082.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MITDGQIFLALTVALTAAIFAIGLGRQLY

Entity 11 Entity 11 polymer

Description description	Fucoxanthin chlorophyll a/c binding protein III (FCPI-3)
Molecular weight formula_weight	21458.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MTATAFSGPSLPVGRAAAPAISMMAERSASIPFLNKPPALDGSMVGDVGFDPLGFSTTITELGGDLNYVREAELMHGRQAMLATVGFVFPSIFGKIPSDWSASVSTDPLVAQYQLPGTVLGQLIFSIAVAEGIRASIIFKKDSVPGEHGFDPAGFIPKFCNTPEKMAEMKLKELKHCRIAMIAITGFFFQETITGHVVPFL

Entity 12 Entity 12 polymer

Description description	Fucoxanthin chlorophyll a/c binding protein VI (FCPI-6), GLY-CYS-PRO
Molecular weight formula_weight	24382.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MLSLVASAPAFVPPTGLVAPAMQPLTQIRMAEGPMYDAPLAPSGMGAEFINAERAPISSYVGASWEAGDVVYDPLDLCELWKVSANNPDAAFLREAELKHCRLAMLAFAGIIHTSAGFHIPGEIWAVDDWSAALSTVQAKNPAALGQIFAGIGIIEGYTSKGVFDMWFGKTTVRAPGKLGFDPLGLMPKDKEGAAKMELSELKNGRMAMIAVAGIACNHYIPGSVPGCPFP

Entity 13 Entity 13 polymer

Description description	Fucoxanthin chlorophyll a/c binding protein IV (FCPI-4)
Molecular weight formula_weight	21064.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MLSLVSGSLAFTAPLTPAVTQTRAHAPNMLKSQALPFVEAPKALDGSMVGDVGFDPLNLSDGLDLKFMREAELKHGRICMLAWLGYVVVDLGITAPGAPSVSSLAAHDTAVKEGAMYLLLMLVSGFEAISTPAVYEMMSGQSDRKPGDFQLDPFGWAKGDKAEKMMLSEVIHCRTAMLAFSGVVTQSALKEIGFPYF

Entity 14 Entity 14 polymer

Description description	Photosystem I reaction center subunit psaR
Molecular weight formula_weight	9637.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MELKAQDTWWGDKDYPDSIVLGIGKGVPSIVYSVSSLIALALGSYCVAESNLLNILSGSTVNGFYVVGAVLVPYSWGLHVAAWIQKQNGK

Entity 15 Entity 15 polymer

Description description	Fucoxanthin chlorophyll a/c binding protein II (FCPI-2)
Molecular weight formula_weight	22708.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MAVRTLLLCAAIGSAAALTAPVTRAVRPAVRRTTDVQAVVNFDSAASQWNAEFPYLAKFGFGPSAKAERWNGRHAMFGWVVIVATGYAQSHGLIPSPDVPLSYSSWGGLAQMGFNEYITNERAVIMIAHTHFLAFSLAAAFGPKVLDSLTLANGESDEEPAGFMPAIQPGLTASAELLNGRMAMLGLVLLVLTSAFTGKEILDVVNIGLGGLLLK

Entity 16 Entity 16 polymer

Description description	Fucoxanthin chlorophyll a/c binding protein I (FCPI-1)
Molecular weight formula_weight	20547.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAAYLISLASPSFVPGAAVHHIAPTITSQQQIVAKVDGLVGDSAPLGFFDPLGYTKKASPADLKKYRECELKHGRVAMLASMGMVVADFWHPLYGGGNSANPLVAITQVPKAGLLQILAFIGFMEVMGQLNMQRADYEPGNFLGSGQWETSESWDDYQTRELNNGRLAMFASIGMLAHAALTGKGPLELIF

Entity 17 Entity 17 polymer

Description description	Fucoxanthin chlorophyll a/c binding protein V (FCPI-5)
Molecular weight formula_weight	21379.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MISMVNAALAFAGQHAVLNGVARATAPVMQQKSQSVPFLDRPAALDGTMVGDVGFDPLGISSGIPMAWLRESELKHGRVCMLATVGYIAVDMGIRAPYAETLSVTSLTAHDATVATGQMWLLLIACGVLEVAGAAGIAATLSGSDRKPGYFAFDPLGFGKDPKQMERMELSEIKNGRLAMLAFSGIVTQDALFEHAKNFPYL

Entity 18 Entity 18 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	145

Entity 19 Entity 19 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 20 Entity 20 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 21 Entity 21 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 22 Entity 22 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 23 Entity 23 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 24 Entity 24 non-polymer

Description description	(3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol
Molecular weight formula_weight	582.9 kDa
Source method src_method	syn
Copy count entity_count	23

Entity 25 Entity 25 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 26 Entity 26 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 27 Entity 27 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 28 Entity 28 non-polymer

Description description	Chlorophyll c1
Molecular weight formula_weight	610.9 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 29 Entity 29 non-polymer

Description description	;(3S,3'S,5R,5'R,6S,6'R,8'R)-3,5'-dihydroxy-8-oxo-6',7'-didehydro-5,5',6,6',7,8-hexahydro-5,6-epoxy-beta,beta-caroten-3'- yl acetate ;
Molecular weight formula_weight	658.9 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 30 Entity 30 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	790

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.89 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	114380

PSI-6 FCPI supercomplex from haptophyte Chrysotila roscoffensis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Assembly Composition of the Current Entry

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9uof__assembly_1__model_1

9uof__assembly_1__model_1 | I(q)

9uof__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (30)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

Entity 13 Entity 13 polymer

Polymer Polymer

Entity 14 Entity 14 polymer

Polymer Polymer

Entity 15 Entity 15 polymer

Polymer Polymer

Entity 16 Entity 16 polymer

Polymer Polymer

Entity 17 Entity 17 polymer

Polymer Polymer

Entity 18 Entity 18 non-polymer

Entity 19 Entity 19 non-polymer

Entity 20 Entity 20 non-polymer

Entity 21 Entity 21 non-polymer

Entity 22 Entity 22 non-polymer

Entity 23 Entity 23 non-polymer

Entity 24 Entity 24 non-polymer

Entity 25 Entity 25 non-polymer

Entity 26 Entity 26 non-polymer

Entity 27 Entity 27 non-polymer

Entity 28 Entity 28 non-polymer

Entity 29 Entity 29 non-polymer

Entity 30 Entity 30 water

7. Citations (1)