← Back to search

9v3e

A broad-spectrum neutralizing antibody targeting the F protein of NiV and HeV

Method: ELECTRON MICROSCOPY D_max: 118.2 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9v3e
deposition_date	2025-05-21
title	A broad-spectrum neutralizing antibody targeting the F protein of NiV and HeV
keywords	;C-type nanoantibody, Nipah virus, Hendra virus, fusion glycoprotein, VIRAL PROTEIN/IMMUNE SYSTEM, VIRAL PROTEIN-IMMUNE SYSTEM complex ;; VIRAL PROTEIN/IMMUNE SYSTEM
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	37.82 Å
rg_electron	36.90 Å
i0	517507000.00
molecular_weight	187150.0 kDa
excluded_volume	235420 Å³
envelope_volume	302840 Å³
shell_volume	66802 Å³
envelope_diameter	126.1 Å
shell_rg	44.26 Å
envelope_rg	36.81 Å
shape_rg	36.86 Å
total_rg	37.49 Å
total_atoms	13119
n_residues	1671
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	118.2 Å
rg_real	37.59 Å
rg_real_error	0.87 Å
i0_real	5.1750e+08
i0_real_error	8.2200e+06
rg_reciprocal	37.73 Å
i0_reciprocal	517600000.0000
total_estimate	0.8901
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	50.6 Å
skewness	0.145
kurtosis	-0.415
angular_range	— – 0.2100 Å⁻¹
current_alpha	0.0000
highest_alpha	69150000.0000
n_real_points	43
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.903; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.973; Smooth: 0.885

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Fusion glycoprotein F0
formula_weight	55495.4 kDa
src_method	man
entity_count	3

Polymer

type	polypeptide(L)
strand_id	A,B,C
atom_count	13119

ILHYEKLSKIGLVKGVTRKYKIKSNPLTKDIVIKMIPNVSNMSQCTGSVMENYKTRLNGILTPIKGALEIYKNNTHDCVGDVRLAGVCMAGVAIGIATAAQITAGVALYEAMKNADNINKLKSSIESTNEAVVKLQETAEKTVYVFTALQDYINTNLVPTIDKIPCKQTELSLDLALSKYLSDLLFVFGPNLQDPVSNSMTIQAISQAFGGNYETLLRTLGYATEDFDDLLESDSITGQIIYVDLSSYYIIVRVYFPILTEIQQAYIQELLPVSFNNDNSEWISIVPNFILVRNTLISNIEIGFCLITKRSVICNQDYATPMTNNMRECLTGSTEKCPRELVVSSHVPRFALSNGVLFANCISVTCQCQTTGRAISQSGEQTLLMIDNTTCPTAVLGNVIISLGKYLGSVNYNSEGIAIGPPVFTDKVDISSQISSMNQSLQQSKDYIKEAQRLLDTVNPSMKQIEDKIEEILSKIYHIENEIARIKKLIGEGSGGHHHHHH

Source

organism	Nipah virus
ncbi_taxonomy_id	3052225
host_organism	Homo sapiens

Entity 2 polymer

description	C-type nanoantibody
formula_weight	15008.8 kDa
src_method	man
entity_count	3

Polymer

type	polypeptide(L)
strand_id	E,F,G

APSVLCLPPKPKDILMISRTPEVTCVVSDDSHSLHRVKFRWYVDGVEVHNAWTEPRDDYFNTTDRVVSKLTVLHQDWLNGKEYKCKVSARLYGHIVPWNQGPTECTISKANGQAGHHHHHHGDYKDDDDKG

Source

organism	Homo sapiens
ncbi_taxonomy_id	9606
host_organism	Escherichia coli BL21(DE3)

Entity 3 non-polymer

description	2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	221.2 kDa
src_method	syn
entity_count	12

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	3.10 Å
resolution_method	—
num_particles	226602

fit	/app/data/saxs_computation/v3/9v3e/9v3e.fit
pddf	/app/data/pr_computation/v3/9v3e/9v3e.pr.out
profile	/app/data/saxs_computation/v3/9v3e/9v3e.dat

A broad-spectrum neutralizing antibody targeting the F protein of NiV and HeV

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

EM 3D

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 non-polymer

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)