← Back to search

9v3f

A neutralizing antibody targeting the F protein of NiV

Method: ELECTRON MICROSCOPY D_max: 121.5 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9v3f
deposition_date	2025-05-21
title	A neutralizing antibody targeting the F protein of NiV
keywords	C-type nanoantibody, Nipah virus, fusion glycoprotein, VIRAL PROTEIN/IMMUNE SYSTEM, VIRAL PROTEIN-IMMUNE SYSTEM complex; VIRAL PROTEIN/IMMUNE SYSTEM
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	38.02 Å
rg_electron	37.19 Å
i0	458097000.00
molecular_weight	178720.0 kDa
excluded_volume	225910 Å³
envelope_volume	291270 Å³
shell_volume	64332 Å³
envelope_diameter	129.1 Å
shell_rg	44.09 Å
envelope_rg	36.96 Å
shape_rg	37.16 Å
total_rg	37.75 Å
total_atoms	12535
n_residues	1596
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	121.5 Å
rg_real	37.81 Å
rg_real_error	0.80 Å
i0_real	4.5810e+08
i0_real_error	7.6610e+06
rg_reciprocal	37.95 Å
i0_reciprocal	458200000.0000
total_estimate	0.8817
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	49.2 Å
skewness	0.174
kurtosis	-0.337
angular_range	— – 0.2100 Å⁻¹
current_alpha	0.0000
highest_alpha	66570000.0000
n_real_points	43
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.864; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.978; Smooth: 0.887

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Fusion glycoprotein F0
formula_weight	55495.4 kDa
src_method	man
entity_count	3

Polymer

type	polypeptide(L)
strand_id	A,B,C
atom_count	12535

ILHYEKLSKIGLVKGVTRKYKIKSNPLTKDIVIKMIPNVSNMSQCTGSVMENYKTRLNGILTPIKGALEIYKNNTHDCVGDVRLAGVCMAGVAIGIATAAQITAGVALYEAMKNADNINKLKSSIESTNEAVVKLQETAEKTVYVFTALQDYINTNLVPTIDKIPCKQTELSLDLALSKYLSDLLFVFGPNLQDPVSNSMTIQAISQAFGGNYETLLRTLGYATEDFDDLLESDSITGQIIYVDLSSYYIIVRVYFPILTEIQQAYIQELLPVSFNNDNSEWISIVPNFILVRNTLISNIEIGFCLITKRSVICNQDYATPMTNNMRECLTGSTEKCPRELVVSSHVPRFALSNGVLFANCISVTCQCQTTGRAISQSGEQTLLMIDNTTCPTAVLGNVIISLGKYLGSVNYNSEGIAIGPPVFTDKVDISSQISSMNQSLQQSKDYIKEAQRLLDTVNPSMKQIEDKIEEILSKIYHIENEIARIKKLIGEGSGGHHHHHH

Source

organism	Nipah virus
ncbi_taxonomy_id	3052225
host_organism	Homo sapiens

Entity 2 polymer

description	C-type nanoantibody
formula_weight	15228.3 kDa
src_method	man
entity_count	3

Polymer

type	polypeptide(L)
strand_id	E,F,G

APSVLCFPPKPKDILMISRTPEVTCVVKGYTDFPLNYTFKWYVDGVEVHNAKTIPRYDTHTYNSRVVSKLTVLHQDWLNGKEYKCKVIARPGDYYYYMDVWPIECTISKAKGQAGHHHHHHGDYKDDDDKG

Source

organism	Homo sapiens
ncbi_taxonomy_id	9606
host_organism	Escherichia coli BL21(DE3)

Entity 3 non-polymer

description	2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	221.2 kDa
src_method	syn
entity_count	9

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	2.80 Å
resolution_method	—
num_particles	660304

fit	/app/data/saxs_computation/v3/9v3f/9v3f.fit
pddf	/app/data/pr_computation/v3/9v3f/9v3f.pr.out
profile	/app/data/saxs_computation/v3/9v3f/9v3f.dat

A neutralizing antibody targeting the F protein of NiV

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

EM 3D

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 non-polymer

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)