SAXSdb — 9v7i

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycocyanin beta chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Phycobilisome rod linker polypeptide CpcC1 × 1 Phycocyanin alpha chain × 12 （Q7M7F7） Phycobilisome rod linker polypeptide CpcC2 × 1 Glr1262 protein × 1 （Q7NL64） PHYCOCYANOBILIN × 36	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7M7C7_GLOVI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–172； UniProt 1–172 Author chain D； PDBConstruct 1–172； UniProt 1–172 Author chain F； PDBConstruct 1–172； UniProt 1–172 Author chain H； PDBConstruct 1–172； UniProt 1–172 Author chain J； PDBConstruct 1–172； UniProt 1–172 Author chain L； PDBConstruct 1–172； UniProt 1–172 Author chain O； PDBConstruct 1–172； UniProt 1–172 Author chain Q； PDBConstruct 1–172； UniProt 1–172 Author chain S； PDBConstruct 1–172； UniProt 1–172 Author chain U； PDBConstruct 1–172； UniProt 1–172 Author chain W； PDBConstruct 1–172； UniProt 1–172 Author chain Y； PDBConstruct 1–172； UniProt 1–172

Phycocyanin alpha chain

OrganismNot specified

UniProt Q7M7F7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Phycobilisome rod linker polypeptide CpcC1 × 1 Phycocyanin beta chain × 12 （Q7M7C7） Phycobilisome rod linker polypeptide CpcC2 × 1 Glr1262 protein × 1 （Q7NL64） PHYCOCYANOBILIN × 36	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7M7F7_GLOVI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–162； UniProt 1–162 Author chain E； PDBConstruct 1–162； UniProt 1–162 Author chain G； PDBConstruct 1–162； UniProt 1–162 Author chain I； PDBConstruct 1–162； UniProt 1–162 Author chain K； PDBConstruct 1–162； UniProt 1–162 Author chain N； PDBConstruct 1–162； UniProt 1–162 Author chain P； PDBConstruct 1–162； UniProt 1–162 Author chain R； PDBConstruct 1–162； UniProt 1–162 Author chain T； PDBConstruct 1–162； UniProt 1–162 Author chain V； PDBConstruct 1–162； UniProt 1–162 Author chain X； PDBConstruct 1–162； UniProt 1–162 Author chain a； PDBConstruct 1–162； UniProt 1–162

Glr1262 protein

OrganismNot specified

UniProt Q7NL64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Phycobilisome rod linker polypeptide CpcC1 × 1 Phycocyanin beta chain × 12 （Q7M7C7） Phycocyanin alpha chain × 12 （Q7M7F7） Phycobilisome rod linker polypeptide CpcC2 × 1 PHYCOCYANOBILIN × 36	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7NL64_GLOVI
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Z； PDBConstruct 1–824； UniProt 1–824

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9v7i
Deposition date deposition_date	2025-05-28
Structure title title	Phycobilisome rod R3 from Gloeobacter violaceus PCC 7421
Keywords keywords	Phycobilisome, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9v7i__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9v7i__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9v7i__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.99 Å
Rg (electron density)	49.13 Å
Total Rg	49.42 Å
Atom count	36438
Residues	4567
Excluded volume	647350 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9v7i__assembly_1__model_1`	27-meric （27）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Phycobilisome rod linker polypeptide CpcC1
Molecular weight formula_weight	31085.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	36438

MSVLTGDNQQRGSKLFKITIALSPTLAHHPWPGLDTHEPSQSSYSTIVSLERLLPEMTRIKRNGGRILEITEGEASESRANFPAVMEPPVVELYPRAGEAEVQAVIAVAYKQVFGNIHVMESERIVSAESLLRNRSISVREFVRLLAKSDLYKESFFHCTSNNRFIELNFKHLLGRAPYNHSEIIEHLDRYQSQGYDAEIDSYIDSDEYVKTFGENVVPYHRGFKSQVGQQSVAAFERMIRLFGGDASSDTSLNRTGQKRLVDPKQLLRSGRGIV

Entity 2 Entity 2 polymer

Description description	Phycocyanin beta chain
Molecular weight formula_weight	18479.0 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L,O,Q,S,U,W,Y

MQDAFTKAIVAADLRGSFLSEQELNQLTNLVKESNKRLDAVNAITGNAAEIISDAAHKLFAEQTDLIRPGGNAYPNRRMAACLRDMEIILRYVSYALLAGDASVLEDRCLNGLKETYVALGTPTRSVARAVQLMKETAIGYVNSPSGVTRGDCSALVNEAATYFDKAAASIA

Entity 3 Entity 3 polymer

Description description	Phycocyanin alpha chain
Molecular weight formula_weight	17679.9 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,E,G,I,K,N,P,R,T,V,X,a

MKTVITEVIASADSQGRFLNNTELQAANGRFQRATASMEAARALTSNADSLVKGAVQEVYNKFPYLTQPGQMGYGDTNQAKCARDISHYLRFITYSLVAGGTGPLDDYIVAGLREVNRTFNLSPSWYIEALKHIKGKVGSQLSGQPLTEANAYIDYCINALS

Entity 4 Entity 4 polymer

Description description	Phycobilisome rod linker polypeptide CpcC2
Molecular weight formula_weight	30913.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MNVLTTSSQRGGKLFKVTMTLSPALSHHPWPSLDTYEPSQNSYSVVVPLDRLLAEMTYIKNKGGRVLDISPADLEALGPPDISSVAIPLKVELWAKADVSDVQAAIVAAYKQIFGNTYVLESERLTSAESLLRNGSISVREFVRLLAKSELYKERFFFCTSNNRFTELNFKHFLGRAPYNQSEIAAHLDRYQTFGYDAEIDSYIDSDEYIQAFGENVVPYYRGFKSQSGQTVESFNRMFKLYRGDAGSDTNLNLQGQKRRVDPKNLLRSGRGIV

Entity 5 Entity 5 polymer

Description description	Glr1262 protein
Molecular weight formula_weight	92127.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MSTVLDDQSKAYAPGSANGPTAGLEPFVRMSRMIRSGVPEDREEPDELWLSMVRDIFGRGYMDRLSQTRAIDYSAFVRPADQATADGAAQTKLGITAIAPDQGVELRPNFTEADVITVIRAAYKQLFGNTYILESERVIQAESLLRNGSISVREFIRILAKSDLYKERFFRCTSNNRFIELNLKHLLGRAPYNQGEIAEHLDRYCQSGYDAEIDSYIDSDEYRRVFGENTVPYFRGFKYQVGQSAAAFERMRALYSGDAGSDTDRNQNGQRTELTSGLADPAQPVRARTDYALTRVDIPGGNGAAGRLAALDESLGSWLDAARDLISQNDYSQKAIEVEPKRVAPYAQYLTPAVEATPDAAAQTKLGITAVAPDQAVELRPNFGEAEVQAVIRAAYKQIFGNTYILEADRVVIAESLLRNGSISVREFVRLLAKSDLYRDRFFRTASNNRFIELNFKHFLGRAPYSQAEIGEHFNRYHKSGYDAEIDSYIDSDEYRRVFGENTVPYFRGFKYQVGQAARGFDQMQQLFAGDAGSDTDRGIGAQPAAKLTFPLSRPLGVTSAYFPSSQGGAATSDGLEMFTRMARELTVTPVSARRTTSPTAPTAPAMPLAGYYSRPAPRATADGDAQTKLGITAVAPAQAVELRPNFGETELQAVIRATYKQLFGNTYILEADRVVQAESLLRNGSINVREFVRLLAKSELYKERFFHCTSNNRFIELTFKHLLGRAPYNQSEFVEHLDRYQKSGYDAEIDSYIDSDEYRRVFGENTVPYFRGFKYQTGQAAGVFERTLKLYGGDADSDTNRNRQGQLRQVDPQELLRSGRGIV

Entity 6 Entity 6 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	36

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.030 Å
Low-resolution limit resolution_low	3.030 Å
R factor r_factor	—
R_work r_work	0.3276
R_free r_free	—

Resolution resolution	3.03 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	746972

Phycobilisome rod R3 from Gloeobacter violaceus PCC 7421

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycocyanin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Phycocyanin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Glr1262 protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9v7i__assembly_1__model_1

9v7i__assembly_1__model_1 | I(q)

9v7i__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)

Phycobilisome rod R3 from Gloeobacter violaceus PCC 7421

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycocyanin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycocyanin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Glr1262 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9v7i__assembly_1__model_1

9v7i__assembly_1__model_1 | I(q)

9v7i__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)