← Back to search

9vsq

The TUG-891-bound structure of TMEM175

Method: ELECTRON MICROSCOPY D_max: 94.4 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9vsq
deposition_date	2025-07-09
title	The TUG-891-bound structure of TMEM175
keywords	TMEM175, cro-EM, TUG-891, Parkinson, lysosome, MEMBRANE PROTEIN; MEMBRANE PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	28.58 Å
rg_electron	27.63 Å
i0	107874000.00
molecular_weight	92531.0 kDa
excluded_volume	120420 Å³
envelope_volume	144430 Å³
shell_volume	41592 Å³
envelope_diameter	99.6 Å
shell_rg	36.55 Å
envelope_rg	28.03 Å
shape_rg	27.65 Å
total_rg	28.51 Å
total_atoms	6513
n_residues	824
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	94.4 Å
rg_real	28.41 Å
rg_real_error	0.63 Å
i0_real	1.0790e+08
i0_real_error	1.4870e+06
rg_reciprocal	28.49 Å
i0_reciprocal	107900000.0000
total_estimate	0.8728
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	37.8 Å
skewness	0.131
kurtosis	-0.351
angular_range	— – 0.2750 Å⁻¹
current_alpha	0.0000
highest_alpha	20520000.0000
n_real_points	56
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.783; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.996; Smooth: 0.996

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Endosomal/lysosomal proton channel TMEM175
formula_weight	55667.2 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	6553

MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRALYRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQQTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMFAKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLARPEHPPPAPTGQDDPQSQLLPAPC

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Mammalian expression vector EGFP-MCS-pcDNA3.1

Entity 2 non-polymer

description	;3-{4-[(4-fluoro-4'-methyl[1,1'-biphenyl]-2-yl)methoxy]phenyl}propanoic acid ;
formula_weight	364.4 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	CHOLESTEROL
formula_weight	386.7 kDa
src_method	syn
entity_count	2

Entity 4 non-polymer

description	POTASSIUM ION
formula_weight	39.1 kDa
src_method	syn
entity_count	7

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	40

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	2.74 Å
resolution_method	—
num_particles	98355

fit	/app/data/saxs_computation/vs/9vsq/9vsq.fit
pddf	/app/data/pr_computation/vs/9vsq/9vsq.pr.out
profile	/app/data/saxs_computation/vs/9vsq/9vsq.dat