SAXSdb — 9vyg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Adaptor protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Stabilization protein × 6 （A0AA49CMB9） Needle protein × 3 （A0AA49CMD6） Tail spike protein × 1 （A0AA49HGR3） Tail spike protein × 1 （A0AA49HGR3） Tail spike protein × 1 （A0AA49HGR3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0AA49CMD5_9CAUD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–186； UniProt 1–186 Author chain B； PDBConstruct 1–186； UniProt 1–186 Author chain C； PDBConstruct 1–186； UniProt 1–186 Author chain D； PDBConstruct 1–186； UniProt 1–186 Author chain E； PDBConstruct 1–186； UniProt 1–186 Author chain F； PDBConstruct 1–186； UniProt 1–186 Author chain G； PDBConstruct 1–186； UniProt 1–186 Author chain H； PDBConstruct 1–186； UniProt 1–186 Author chain I； PDBConstruct 1–186； UniProt 1–186 Author chain J； PDBConstruct 1–186； UniProt 1–186 Author chain K； PDBConstruct 1–186； UniProt 1–186 Author chain L； PDBConstruct 1–186； UniProt 1–186

Stabilization protein

OrganismNot specified

UniProt A0AA49CMB9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Adaptor protein × 12 （A0AA49CMD5） Needle protein × 3 （A0AA49CMD6） Tail spike protein × 1 （A0AA49HGR3） Tail spike protein × 1 （A0AA49HGR3） Tail spike protein × 1 （A0AA49HGR3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0AA49CMB9_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain M； PDBConstruct 1–446； UniProt 1–446 Author chain N； PDBConstruct 1–446； UniProt 1–446 Author chain O； PDBConstruct 1–446； UniProt 1–446 Author chain P； PDBConstruct 1–446； UniProt 1–446 Author chain Q； PDBConstruct 1–446； UniProt 1–446 Author chain R； PDBConstruct 1–446； UniProt 1–446

Needle protein

OrganismNot specified

UniProt A0AA49CMD6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Adaptor protein × 12 （A0AA49CMD5） Stabilization protein × 6 （A0AA49CMB9） Tail spike protein × 1 （A0AA49HGR3） Tail spike protein × 1 （A0AA49HGR3） Tail spike protein × 1 （A0AA49HGR3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0AA49CMD6_9CAUD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain S； PDBConstruct 1–69； UniProt 1–69 Author chain T； PDBConstruct 1–69； UniProt 1–69 Author chain U； PDBConstruct 1–69； UniProt 1–69

Tail spike protein

OrganismNot specified

UniProt A0AA49HGR3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Adaptor protein × 12 （A0AA49CMD5） Stabilization protein × 6 （A0AA49CMB9） Needle protein × 3 （A0AA49CMD6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0AA49HGR3_9CAUD
Isoform	—
PDB entities	4, 5, 6
Chains and sequence ranges	Author chain m； PDBConstruct 1–128； UniProt 1–128 Author chain n； PDBConstruct 1–129； UniProt 2–132 Author chain o； PDBConstruct 1–126； UniProt 2–127

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9vyg
Deposition date deposition_date	2025-07-21
Structure title title	Cyanopodophage Pan3 tail complex
Keywords keywords	Cyanophage, Virus, Tail, Adaptor, Nozzle, Needle, Tailspike, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9vyg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9vyg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9vyg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	58.62 Å
Rg (electron density)	57.84 Å
Total Rg	57.86 Å
Atom count	41366
Residues	5440
Excluded volume	728810 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9vyg__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Adaptor protein
Molecular weight formula_weight	19930.5 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L
Atom count atom_count	41366

MATCRDIVTRALHMAAIVPLGKDPKAAEGQLGLELLQGLYDGWFAGGMFGRLTDVYTDTAYTAKEGERVTVDGGTLTIPDTFEDTDTGLTRAPRELAAIVEINAGNITNRVWCGGEWQECSGLTLNDEAPLSKRDAMGLSCLLALHMAEAFGTQIGPMTARRGLQFQGSVSYKLGSTQPDASGVYY

Entity 2 Entity 2 polymer

Description description	Stabilization protein
Molecular weight formula_weight	48753.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,O,P,Q,R

MDLAYGTGAYARTRGNLPELPLVNLFVEATRSDQRGVVLQSRKGLVEDAEVGTGPIRGVFRKDGVLGGAEFVVSDDELYEDGVSLGTINGTGPVSFAAIEDELLVCAGESIWSYDGTTLDEVTFPDGADVTKVAYSSGYFIALRAGTGQWYFSALYDGTSWDGLDFATAESEPDALLDIVVLDGNPVFFGTQSVEFWSATGDPDIPFAPIQNRTFEQGIFATGCAVAIDNSFFWVGADKIVYRNDAVPVAVADDGIVERATGSTDLRLFLLIDERHKFVCLRGDTFTMAFDITTNEWCEFQSYGRTNFRCGPDMGDDETGIIWRFEGYSDNGGVLERRFRAGATLPGPFRVNRLRLICEVGTTPNLSGEYADPVIEMRASDDAGNTWGIWEGETLGAQGNYRQRVEWRALGLFDDPGMLFEHRMTAPVSFRVTAVTVNGELGGRSR

Entity 3 Entity 3 polymer

Description description	Needle protein
Molecular weight formula_weight	7375.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T,U

VSLRLDRLQRGVPIVDGQGRPNTQYQNLWQRTVKALEADSAATADILQELADQLALIVAAQAAADAAQA

Entity 4 Entity 4 polymer

Description description	Tail spike protein
Molecular weight formula_weight	13478.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MAAQLFYLPFRPMLDANALAVPGAKLYFYATGTTTKQPVYTSSALTTQLPNPVVANAAGKFPAIYLNDALTYRCYIEDADGNELADSDPYLASIADELTDELQDVVDAVEADRVAAANSATAAATSAA

Entity 5 Entity 5 polymer

Description description	Tail spike protein
Molecular weight formula_weight	13576.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

AAQLFYLPFRPMLDANALAVPGAKLYFYATGTTTKQPVYTSSALTTQLPNPVVANAAGKFPAIYLNDALTYRCYIEDADGNELADSDPYLASIADELTDELQDVVDAVEADRVAAANSATAAATSAAQT

Entity 6 Entity 6 polymer

Description description	Tail spike protein
Molecular weight formula_weight	13276.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

AAQLFYLPFRPMLDANALAVPGAKLYFYATGTTTKQPVYTSSALTTQLPNPVVANAAGKFPAIYLNDALTYRCYIEDADGNELADSDPYLASIADELTDELQDVVDAVEADRVAAANSATAAATSA

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.500 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	119673

Cyanopodophage Pan3 tail complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Adaptor protein

State in the Current Structure

Other States of the Same Protein in the Database

Stabilization protein

State in the Current Structure

Other States of the Same Protein in the Database

Needle protein

State in the Current Structure

Other States of the Same Protein in the Database

Tail spike protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9vyg__assembly_1__model_1

9vyg__assembly_1__model_1 | I(q)

9vyg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

7. Citations (1)

Cyanopodophage Pan3 tail complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Adaptor protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Stabilization protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Needle protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail spike protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9vyg__assembly_1__model_1

9vyg__assembly_1__model_1 | I(q)

9vyg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

7. Citations (1)