← Back to search

9wy3

Crystal structure of Frog M-ferritin E130A_L165D mutant

Method: X-RAY DIFFRACTION D_max: 69.8 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9wy3
deposition_date	2025-09-26
last_revision	2026-04-15
title	Crystal structure of Frog M-ferritin E130A_L165D mutant
keywords	Ferritin, Iron storage and transfer, METAL TRANSPORT; METAL TRANSPORT
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	19.36 Å
rg_electron	18.41 Å
i0	8696940.00
molecular_weight	20710.0 kDa
excluded_volume	25425 Å³
envelope_volume	29783 Å³
shell_volume	14524 Å³
envelope_diameter	68.9 Å
shell_rg	23.35 Å
envelope_rg	18.79 Å
shape_rg	18.33 Å
total_rg	19.43 Å
total_atoms	1443
n_residues	174
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	69.8 Å
rg_real	19.50 Å
rg_real_error	0.60 Å
i0_real	8.6970e+06
i0_real_error	1.2630e+05
rg_reciprocal	19.48 Å
i0_reciprocal	8697000.0000
total_estimate	0.8081
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	19.7 Å
skewness	0.530
kurtosis	-0.226
angular_range	— – 0.4100 Å⁻¹
current_alpha	0.0000
highest_alpha	1926000.0000
n_real_points	72
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.612; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.668; Smooth: 0.998

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Ferritin, middle subunit
formula_weight	20480.0 kDa
ec_number	1.16.3.1
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	1710

MVSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQDIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDKVDPHLCDFLASEYLEEQVKDIKRIGDFITNLKRLGLPENGMGEYDFDKHSVKES

Source

organism	Aquarana catesbeiana
common_name	American bullfrog
ncbi_taxonomy_id	8400
host_organism	Escherichia coli

Entity 2 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	7

Entity 3 non-polymer

description	CHLORIDE ION
formula_weight	35.5 kDa
src_method	syn
entity_count	7

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	208

▶

6. Citations (1)

▶

length_a	183.760 Å
length_b	183.760 Å
length_c	183.760 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	96

space_group	F 4 3 2
int_tables_number	209
crystal_system	—

resolution	1.770 Å
resolution_low	35.390 Å
r_factor	—
r_work	0.1570
r_free	0.1880

fit	/app/data/saxs_computation/wy/9wy3/9wy3.fit
pddf	/app/data/pr_computation/wy/9wy3/9wy3.pr.out
profile	/app/data/saxs_computation/wy/9wy3/9wy3.dat

Crystal structure of Frog M-ferritin E130A_L165D mutant

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction