← Back to search

9x0i

Glyoxysomal Citrate Synthase 3 from Arabidopsis thaliana in complex with OAA and CoA

Method: X-RAY DIFFRACTION D_max: 89.5 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9x0i
deposition_date	2025-09-30
title	Glyoxysomal Citrate Synthase 3 from Arabidopsis thaliana in complex with OAA and CoA
keywords	citrate synthase, glyoxysome, glyoxylate cycle, Arabidopsis, TRANSFERASE; TRANSFERASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	28.73 Å
rg_electron	27.85 Å
i0	156063000.00
molecular_weight	100150.0 kDa
excluded_volume	125850 Å³
envelope_volume	148680 Å³
shell_volume	42453 Å³
envelope_diameter	95.1 Å
shell_rg	37.01 Å
envelope_rg	28.13 Å
shape_rg	27.85 Å
total_rg	28.70 Å
total_atoms	7044
n_residues	881
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	89.5 Å
rg_real	28.60 Å
rg_real_error	0.52 Å
i0_real	1.5610e+08
i0_real_error	2.1790e+06
rg_reciprocal	28.66 Å
i0_reciprocal	156100000.0000
total_estimate	0.9017
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	1
r_peak_primary	87.9 Å
skewness	0.191
kurtosis	-0.463
angular_range	— – 0.2750 Å⁻¹
current_alpha	0.0000
highest_alpha	40250000.0000
n_real_points	56
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.913; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.993; Smooth: 0.986

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (8)

Entity 1 polymer

description	Citrate synthase 3, peroxisomal
formula_weight	52786.2 kDa
ec_number	2.3.3.16
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	7902

GPLGSDTSVAPLGSLKGTLTIVDERTGKNYKVPVSDDGTVKAVDFKKIVTGKEDKGLKLYDPGYLNTAPVRSSISYIDGDEGILRYRGYPIEEMAENSTFLEVAYLLMYGNLPSESQLSDWEFAVSQHSAVPQGVLDIIQSMPHDAHPMGVLVSAMSALSIFHPDANPALRGQDIYDSKQVRDKQIIRIIGKAPTIAAAAYLRMAGRPPVLPSGNLPYADNFLYMLDSLGNRSYKPNPRLARVLDILFILHAEHEMNCSTAAARHLASSGVDVYTAVAGAVGALYGPLHGGANEAVLKMLSEIGTVENIPEFIEGVKNRKRKMSGFGHRVYKNYDPRAKVIKNLADEVFSIVGKDPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGFPPEFFTVLFAIPRMAGYLSHWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERIVTDDSKESDKLGQVATSNASRRRLAGSSV

Source

organism	Arabidopsis thaliana
common_name	thale cress
ncbi_taxonomy_id	3702
host_organism	Escherichia coli

Entity 2 non-polymer

description	OXALOACETATE ION
formula_weight	131.1 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	COENZYME A
formula_weight	767.5 kDa
src_method	syn
entity_count	2

Entity 4 non-polymer

description	DI(HYDROXYETHYL)ETHER
formula_weight	106.1 kDa
src_method	syn
entity_count	2

Entity 5 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	5

Entity 6 non-polymer

description	1,2-ETHANEDIOL
formula_weight	62.1 kDa
src_method	syn
entity_count	1

Entity 7 non-polymer

description	4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID
formula_weight	238.3 kDa
src_method	syn
entity_count	1

Entity 8 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	787

▶

6. Citations (1)

▶

length_a	193.859 Å
length_b	60.597 Å
length_c	76.864 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 21 21 2
int_tables_number	18
crystal_system	—

resolution	1.700 Å
resolution_low	38.320 Å
r_factor	—
r_work	0.1659
r_free	0.1967

fit	/app/data/saxs_computation/x0/9x0i/9x0i.fit
pddf	/app/data/pr_computation/x0/9x0i/9x0i.pr.out
profile	/app/data/saxs_computation/x0/9x0i/9x0i.dat