← Back to search

9x0v

Crystal structure of Frog M-ferritin E130A_M161E_L165D mutant

Method: X-RAY DIFFRACTION D_max: 69.1 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9x0v
deposition_date	2025-09-30
last_revision	2026-04-15
title	Crystal structure of Frog M-ferritin E130A_M161E_L165D mutant
keywords	Metal binding protein, Metal transport and storage protein, METAL TRANSPORT; METAL TRANSPORT
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	19.35 Å
rg_electron	18.39 Å
i0	8837840.00
molecular_weight	20832.0 kDa
excluded_volume	25510 Å³
envelope_volume	30273 Å³
shell_volume	14674 Å³
envelope_diameter	69.0 Å
shell_rg	23.41 Å
envelope_rg	18.91 Å
shape_rg	18.32 Å
total_rg	19.35 Å
total_atoms	1449
n_residues	174
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	69.1 Å
rg_real	19.49 Å
rg_real_error	0.65 Å
i0_real	8.8380e+06
i0_real_error	1.1610e+05
rg_reciprocal	19.47 Å
i0_reciprocal	8838000.0000
total_estimate	0.8132
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	19.5 Å
skewness	0.532
kurtosis	-0.211
angular_range	— – 0.4100 Å⁻¹
current_alpha	0.0000
highest_alpha	1963000.0000
n_real_points	72
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.628; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.705; Smooth: 0.981

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Ferritin, middle subunit
formula_weight	20477.9 kDa
ec_number	1.16.3.1
mutation	E130QA,M161E,L165D
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	1735

MVSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQDIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDKVDPHLCDFLASEYLEEQVKDIKRIGDFITNLKRLGLPENGEGEYDFDKHSVKES

Source

organism	Aquarana catesbeiana
common_name	American bullfrog
ncbi_taxonomy_id	8400
host_organism	Escherichia coli

Entity 2 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	10

Entity 3 non-polymer

description	CHLORIDE ION
formula_weight	35.5 kDa
src_method	syn
entity_count	8

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	197

▶

6. Citations (1)

▶

length_a	183.545 Å
length_b	183.545 Å
length_c	183.545 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	96

space_group	F 4 3 2
int_tables_number	209
crystal_system	—

resolution	1.800 Å
resolution_low	42.140 Å
r_factor	—
r_work	0.1600
r_free	0.1840

fit	/app/data/saxs_computation/x0/9x0v/9x0v.fit
pddf	/app/data/pr_computation/x0/9x0v/9x0v.pr.out
profile	/app/data/saxs_computation/x0/9x0v/9x0v.dat

Crystal structure of Frog M-ferritin E130A_M161E_L165D mutant

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction