← Back to search

9xv5

Catalytic domain of N1484

Method: X-RAY DIFFRACTION D_max: 52.5 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9xv5
deposition_date	2025-11-25
last_revision	2026-06-03
title	Catalytic domain of N1484
keywords	PET hydrolase, HYDROLASE; HYDROLASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	17.83 Å
rg_electron	16.47 Å
i0	13500600.00
molecular_weight	27445.0 kDa
excluded_volume	34218 Å³
envelope_volume	36679 Å³
shell_volume	18109 Å³
envelope_diameter	51.5 Å
shell_rg	23.13 Å
envelope_rg	16.67 Å
shape_rg	16.47 Å
total_rg	17.43 Å
total_atoms	1932
n_residues	257
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	52.5 Å
rg_real	17.66 Å
rg_real_error	0.20 Å
i0_real	1.3500e+07
i0_real_error	1.4070e+05
rg_reciprocal	17.68 Å
i0_reciprocal	13500000.0000
total_estimate	0.9043
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	24.1 Å
skewness	0.003
kurtosis	-0.530
angular_range	— – 0.4450 Å⁻¹
current_alpha	0.0000
highest_alpha	4688000.0000
n_real_points	75
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.930; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.970; Smooth: 0.990

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Lipase
formula_weight	28603.0 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2294

MADNPYQRGPDPTRTSVTAVNGPFANTSVSVPTGYGFNGGRIYYPTDTSQGTFGAIAISPGYTALFSAELAWMGPWLASHGFVVIGIETNSRNDFDTARGTQLLAALDYLTQQSPVRDRVDPNRLAVAGHSMGGGGALSAAIRRSSLKAVVGIAPYSPSSNLANDRVPTMIFAGQADTVVTPSYATGLYNSLPTTTESVYLEVAGADHGFMVGRSNPVMVRTMLPFVKMFIDNDARYSQFLCPLLDSSGVVTYRSTCPLLEHHHHHH

Source

organism	Micromonospora ureilytica
ncbi_taxonomy_id	709868
host_organism	Escherichia coli

Entity 2 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	nat
entity_count	1

Entity 3 non-polymer

description	1,2-ETHANEDIOL
formula_weight	62.1 kDa
src_method	syn
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	280

▶

6. Citations (1)

▶

length_a	34.239 Å
length_b	84.212 Å
length_c	43.853 Å
angle_alpha	90.00 °
angle_beta	92.78 °
angle_gamma	90.00 °
z_pdb	2

space_group	P 1 21 1
int_tables_number	4
crystal_system	—

resolution	1.400 Å
resolution_low	43.800 Å
r_factor	0.1540
r_work	0.1528
r_free	0.1768

fit	/app/data/saxs_computation/xv/9xv5/9xv5.fit
pddf	/app/data/pr_computation/xv/9xv5/9xv5.pr.out
profile	/app/data/saxs_computation/xv/9xv5/9xv5.dat

Catalytic domain of N1484

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction