← Back to search

9y5g

Crystal Structure of rv-SNARE/sc-t-SNARE-5.s.8 complex

Method: X-RAY DIFFRACTION D_max: 147.1 Å Quality: REASONABLE

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9y5g
deposition_date	2025-09-04
title	Crystal Structure of rv-SNARE/sc-t-SNARE-5.s.8 complex
keywords	membrane fusion proteins, synthetic fusogens, SNARE, protein design, MEMBRANE PROTEIN; MEMBRANE PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	36.43 Å
rg_electron	37.28 Å
i0	88031700.00
molecular_weight	71395.0 kDa
excluded_volume	88202 Å³
envelope_volume	120700 Å³
shell_volume	30186 Å³
envelope_diameter	153.2 Å
shell_rg	37.56 Å
envelope_rg	38.50 Å
shape_rg	37.35 Å
total_rg	37.07 Å
total_atoms	4994
n_residues	598
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	147.1 Å
rg_real	37.13 Å
rg_real_error	2.42 Å
i0_real	8.8030e+07
i0_real_error	1.8270e+06
rg_reciprocal	36.70 Å
i0_reciprocal	87990000.0000
total_estimate	0.7094
solution_quality	REASONABLE a REASONABLE solution
n_peaks	2
r_peak_primary	37.6 Å
skewness	0.749
kurtosis	0.201
angular_range	— – 0.2150 Å⁻¹
current_alpha	0.0000
highest_alpha	5178000.0000
n_real_points	44
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.369; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.175; Smooth: 0.937

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	rv-SNARE/sc-t
formula_weight	8671.7 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,C
atom_count	5302

MSSSSNEKLRETLREVEDVKNIMEDNRRLVERQGRQIDRLEEKADDLERSAERLSDNSEKLKRKYWWKNSK

Source

organism	synthetic construct
ncbi_taxonomy_id	32630
host_organism	Escherichia coli

Entity 2 polymer

description	sc-t-SNARE-5.s.8
formula_weight	28983.9 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	B,D

SGGSSSEREKEIDEGLDRVSEIVKELKKMAEEMRRMIEEQGRRIERIEEKAEEAKEKIEEANERAEKLLKDPGGSGGSEELKKLEKEGEKLKELVEELDREIKELKEGMERLREMFEEAAKLSEEALEIMRRTRKLSEEELEEAKQKAKEQEKEKALKEKGGSGGSGGSEKVKRELAQIEERHQQILELEEKIKELLEMFKELSEKIEEQGQKIDRIEDKVSKAKEHVEKGVEDTKKAVKYQSKARRKK

Source

organism	synthetic construct
ncbi_taxonomy_id	32630
host_organism	Escherichia coli

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	302

▶

6. Citations (1)

▶

length_a	43.182 Å
length_b	45.704 Å
length_c	341.124 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 21 21 21
int_tables_number	19
crystal_system	orthorhombic

resolution	2.100 Å
resolution_low	33.340 Å
r_factor	0.2298
r_work	0.2274
r_free	0.2781

fit	/app/data/saxs_computation/y5/9y5g/9y5g.fit
pddf	/app/data/pr_computation/y5/9y5g/9y5g.pr.out
profile	/app/data/saxs_computation/y5/9y5g/9y5g.dat

Crystal Structure of rv-SNARE/sc-t-SNARE-5.s.8 complex

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)