← Back to search

9y5h

Crystal structure of rv-SNARE/sc-t-SNARE-diff-#3.3 complex

Method: X-RAY DIFFRACTION D_max: 134.9 Å Quality: REASONABLE

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9y5h
deposition_date	2025-09-04
title	Crystal structure of rv-SNARE/sc-t-SNARE-diff-#3.3 complex
keywords	membrane fusion proteins, synthetic fusogens, SNARE, protein design, MEMBRANE PROTEIN; MEMBRANE PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	32.39 Å
rg_electron	34.26 Å
i0	23544700.00
molecular_weight	37027.0 kDa
excluded_volume	46184 Å³
envelope_volume	60418 Å³
shell_volume	18571 Å³
envelope_diameter	136.1 Å
shell_rg	31.68 Å
envelope_rg	35.74 Å
shape_rg	34.27 Å
total_rg	33.98 Å
total_atoms	2594
n_residues	305
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	134.9 Å
rg_real	33.53 Å
rg_real_error	1.93 Å
i0_real	2.3540e+07
i0_real_error	4.3690e+05
rg_reciprocal	33.05 Å
i0_reciprocal	23530000.0000
total_estimate	0.6219
solution_quality	REASONABLE a REASONABLE solution
n_peaks	1
r_peak_primary	19.3 Å
skewness	0.794
kurtosis	-0.023
angular_range	— – 0.2450 Å⁻¹
current_alpha	0.0000
highest_alpha	3188000.0000
n_real_points	50
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.041; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.005; Smooth: 0.954

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	rv-SNARE/sc-t
formula_weight	8671.7 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2624

MSSSSNEKLRETLREVEDVKNIMEDNRRLVERQGRQIDRLEEKADDLERSAERLSDNSEKLKRKYWWKNSK

Source

organism	synthetic construct
ncbi_taxonomy_id	32630
host_organism	Escherichia coli

Entity 2 polymer

description	sc-t-SNARE-diff-#3.3
formula_weight	31069.8 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

SGGSSSSLEKKIDENLEKALELLEELKEKLEEMRRLLEESGRLQDELEELMDETQKQQEELEKLLEKLLKMDDSDEQYELLKEALKKQKELKEQLEELEEKLKELRRAHEETRRKMEEAEELLKELEEVMEELKKAQEELLKEKKKKYEEAKKELEEAKKKGEEGKEKLEKVKRELAQIEERHQQILELEEKIKELLEMFKELSEKIEEQGQKIDRIEDKVSKAKEHVEKGVEDTKKAVKYQSKARRKKCCCCCCCCCCS

Source

organism	synthetic construct
ncbi_taxonomy_id	32630
host_organism	Escherichia coli

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	30

▶

6. Citations (1)

▶

length_a	49.921 Å
length_b	56.550 Å
length_c	130.410 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	orthorhombic

resolution	2.520 Å
resolution_low	42.720 Å
r_factor	0.2421
r_work	0.2360
r_free	0.2939

fit	/app/data/saxs_computation/y5/9y5h/9y5h.fit
pddf	/app/data/pr_computation/y5/9y5h/9y5h.pr.out
profile	/app/data/saxs_computation/y5/9y5h/9y5h.dat

Crystal structure of rv-SNARE/sc-t-SNARE-diff-#3.3 complex

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)