SAXSdb — 9yj4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transforming growth factor beta mimic 6

Heligmosomoides polygyrus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	TGF-beta receptor type-2 × 1 （Q62312） MAGNESIUM ION × 1 SODIUM ION × 1 CHLORIDE ION × 3 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	TGF-beta receptor type-2 × 1 （Q62312） MAGNESIUM ION × 2 SODIUM ION × 3 CHLORIDE ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2P1IQ80_HELBE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–89； UniProt 15–102 Author chain C； PDBConstruct 2–89； UniProt 15–102

TGF-beta receptor type-2

Mus musculus

UniProt Q62312

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Transforming growth factor beta mimic 6 × 1 （A0A2P1IQ80） MAGNESIUM ION × 1 SODIUM ION × 1 CHLORIDE ION × 3 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Transforming growth factor beta mimic 6 × 1 （A0A2P1IQ80） MAGNESIUM ION × 2 SODIUM ION × 3 CHLORIDE ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TGFR2_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–105； UniProt 46–150 Author chain D； PDBConstruct 1–105； UniProt 46–150

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9yj4
Deposition date deposition_date	2025-10-03
Last revision last_revision	2026-05-20
Structure title title	TGM6-D3 bound to mouse TBRII
Keywords keywords	Inhibitor, Complex, TGF-beta, Parasite, Molecular Mimicry, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9yj4__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9yj4__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9yj4__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.38 Å
Rg (electron density)	18.98 Å
Total Rg	19.74 Å
Atom count	1507
Residues	189
Excluded volume	26698 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9yj4__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9yj4__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Transforming growth factor beta mimic 6
Molecular weight formula_weight	10098.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	3150

TGSSCPPLPDDETVWYEYYGYVDGRHTVGDAAIKDSLENYPPNTHARRHCKALSKKADPGEFVAICYQRRGTSESQWQYYPRIASCPDP

Source Source

Source organism organism	Heligmosomoides polygyrus
NCBI taxonomy ID ncbi_taxonomy_id	6339
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	TGF-beta receptor type-2
Molecular weight formula_weight	11999.0 kDa
EC 编号 ec_number	2.7.11.30
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

KLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFS

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	137

▶

Unit-cell length a length_a	53.353 Å
Unit-cell length b length_b	92.589 Å
Unit-cell length c length_c	93.393 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	orthorhombic

Resolution resolution	2.520 Å
Low-resolution limit resolution_low	32.880 Å
R factor r_factor	0.2599
R_work r_work	0.2585
R_free r_free	0.2880

TGM6-D3 bound to mouse TBRII

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transforming growth factor beta mimic 6

State in the Current Structure

Other States of the Same Protein in the Database

TGF-beta receptor type-2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9yj4__assembly_2__model_1

9yj4__assembly_2__model_1 | I(q)

9yj4__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

TGM6-D3 bound to mouse TBRII

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transforming growth factor beta mimic 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

TGF-beta receptor type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9yj4__assembly_2__model_1

9yj4__assembly_2__model_1 | I(q)

9yj4__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)