← Back to search

9z1d

;Isoreticular co-crystal 1 with asymmetrical expanded duplex (31mer) containing insert sequence GCTTGATGAG, crystal soaked in alternate solvent prior to diffraction ;

Method: X-RAY DIFFRACTION D_max: 101.7 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9z1d
deposition_date	2025-11-03
last_revision	2026-02-18
title	;Isoreticular co-crystal 1 with asymmetrical expanded duplex (31mer) containing insert sequence GCTTGATGAG, crystal soaked in alternate solvent prior to diffraction ;
keywords	Protein-DNA complex, DNA Binding protein, Transcription factor; DNA BINDING PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	27.93 Å
rg_electron	27.07 Å
i0	49925500.00
molecular_weight	41284.0 kDa
excluded_volume	45540 Å³
envelope_volume	64333 Å³
shell_volume	22502 Å³
envelope_diameter	105.4 Å
shell_rg	29.93 Å
envelope_rg	27.74 Å
shape_rg	26.90 Å
total_rg	27.67 Å
total_atoms	2834
n_residues	278
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	101.7 Å
rg_real	28.44 Å
rg_real_error	1.15 Å
i0_real	4.9930e+07
i0_real_error	9.0080e+05
rg_reciprocal	28.28 Å
i0_reciprocal	49920000.0000
total_estimate	0.7853
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	28.5 Å
skewness	0.711
kurtosis	0.099
angular_range	— – 0.2850 Å⁻¹
current_alpha	0.0000
highest_alpha	2928000.0000
n_real_points	58
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.631; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.543; Smooth: 0.768

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	DNA (31-MER)
formula_weight	9528.1 kDa
src_method	syn
entity_count	1

Polymer

type	polydeoxyribonucleotide
strand_id	A
atom_count	2848

CCTGTGACAAATTGCCCTCAGGCTTGATGAG

Entity 2 polymer

description	DNA (31-MER)
formula_weight	9537.1 kDa
src_method	syn
entity_count	1

Polymer

type	polydeoxyribonucleotide
strand_id	B

GCTCATCAAGCCTGAGGGCAATTTGTCACAG

Entity 3 polymer

description	Replication initiation protein
formula_weight	30749.1 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	C

MRGSHHHHHHGSMAETAVINHKKRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSDGTLQEHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYRPEEDAGDEKGYESFPWFIKPAHSPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGRQTTHIVFSFRDITSMTTG

Source

organism	Escherichia coli
ncbi_taxonomy_id	562
host_organism	Escherichia coli BL21(DE3)

Entity 4 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	1

▶

6. Citations (2)

▶

length_a	72.375 Å
length_b	124.537 Å
length_c	136.541 Å
angle_alpha	90.00 °
angle_beta	90.17 °
angle_gamma	90.00 °
z_pdb	4

space_group	I 1 2 1
int_tables_number	5
crystal_system	monoclinic

resolution	3.060 Å
resolution_low	39.720 Å
r_factor	0.2955
r_work	0.2929
r_free	0.3184

fit	/app/data/saxs_computation/z1/9z1d/9z1d.fit
pddf	/app/data/pr_computation/z1/9z1d/9z1d.pr.out
profile	/app/data/saxs_computation/z1/9z1d/9z1d.dat

;Isoreticular co-crystal 1 with asymmetrical expanded duplex (31mer) containing insert sequence GCTTGATGAG, crystal soaked in alternate solvent prior to diffraction ;

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (4)

Entity 1 polymer

Polymer

Entity 2 polymer

Polymer

Entity 3 polymer

Polymer

Source

Entity 4 non-polymer

6. Citations (2)

7. Files & Curves (10)

Files (7)

Curves (3)