← Back to search

9zdg

Calcium biosensor with a fluorescence-lifetime readout

Method: X-RAY DIFFRACTION D_max: 79.4 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9zdg
deposition_date	2025-11-25
title	Calcium biosensor with a fluorescence-lifetime readout
keywords	biosensor, calcium, fluorescence lifetime, FLUORESCENT PROTEIN; FLUORESCENT PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	24.42 Å
rg_electron	23.53 Å
i0	36776300.00
molecular_weight	45880.0 kDa
excluded_volume	56968 Å³
envelope_volume	67763 Å³
shell_volume	24490 Å³
envelope_diameter	80.2 Å
shell_rg	29.93 Å
envelope_rg	23.55 Å
shape_rg	23.50 Å
total_rg	24.35 Å
total_atoms	3224
n_residues	403
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	79.4 Å
rg_real	24.42 Å
rg_real_error	0.55 Å
i0_real	3.6780e+07
i0_real_error	5.2890e+05
rg_reciprocal	24.42 Å
i0_reciprocal	36780000.0000
total_estimate	0.8955
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	26.5 Å
skewness	0.347
kurtosis	-0.389
angular_range	— – 0.3250 Å⁻¹
current_alpha	0.0000
highest_alpha	10270000.0000
n_real_points	64
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.893; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.972; Smooth: 0.986

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Tq-FLiTS
formula_weight	50582.3 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	3335

MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWRRKWNKAGHAVRVIGRLSSPVVVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYQGGSGGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLXVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYYSDNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTFDFPEFLTMMARKMNDTDSEEEIREAFRVFDKDGNGYIGAAELRHVMTDLGEKLTDEEVDEMIRVADIDGDGQVNYEEFVQMMTAK

Source

organism	Aequorea victoria
ncbi_taxonomy_id	6100
host_organism	Escherichia coli

Entity 2 non-polymer

description	CALCIUM ION
formula_weight	40.1 kDa
src_method	syn
entity_count	4

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	111

▶

6. Citations (1)

▶

length_a	79.330 Å
length_b	79.330 Å
length_c	170.140 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	6

space_group	P 32 2 1
int_tables_number	154
crystal_system	—

resolution	2.330 Å
resolution_low	34.350 Å
r_factor	0.2149
r_work	0.2119
r_free	0.2522

fit	/app/data/saxs_computation/zd/9zdg/9zdg.fit
pddf	/app/data/pr_computation/zd/9zdg/9zdg.pr.out
profile	/app/data/saxs_computation/zd/9zdg/9zdg.dat

Calcium biosensor with a fluorescence-lifetime readout

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction