9zll

Complex of N-terminal BrxC walker B, BrxB, and N-termianl PglZ from the Acinetobacter BREX system

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative conjugative transfer protein

Acinetobacter sp. NEB 394

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	DUF1788 domain-containing protein × 1 （A0A1L6KSM0） BREX-1 system phosphatase PglZ type A × 1 （A0A558EY06） ADENOSINE-5'-TRIPHOSPHATE × 2 CALCIUM ION × 4 CHLORIDE ION × 1 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	DUF1788 domain-containing protein × 1 （A0A1L6KSM0） BREX-1 system phosphatase PglZ type A × 1 （A0A558EY06） ADENOSINE-5'-TRIPHOSPHATE × 2 CALCIUM ION × 2 MAGNESIUM ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1J0HS39_ACILW
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–553； UniProt 2–552 Author chain B； PDBConstruct 3–553； UniProt 2–552 Author chain C； PDBConstruct 3–553； UniProt 2–552 Author chain D； PDBConstruct 3–553； UniProt 2–552

DUF1788 domain-containing protein

Acinetobacter sp. NEB 394

UniProt A0A1L6KSM0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Putative conjugative transfer protein × 2 （A0A1J0HS39） BREX-1 system phosphatase PglZ type A × 1 （A0A558EY06） ADENOSINE-5'-TRIPHOSPHATE × 2 CALCIUM ION × 4 CHLORIDE ION × 1 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Putative conjugative transfer protein × 2 （A0A1J0HS39） BREX-1 system phosphatase PglZ type A × 1 （A0A558EY06） ADENOSINE-5'-TRIPHOSPHATE × 2 CALCIUM ION × 2 MAGNESIUM ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1L6KSM0_ACIHA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 3–192； UniProt 2–191 Author chain G； PDBConstruct 3–192； UniProt 2–191

BREX-1 system phosphatase PglZ type A

Acinetobacter sp. NEB 394

UniProt A0A558EY06

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Putative conjugative transfer protein × 2 （A0A1J0HS39） DUF1788 domain-containing protein × 1 （A0A1L6KSM0） ADENOSINE-5'-TRIPHOSPHATE × 2 CALCIUM ION × 4 CHLORIDE ION × 1 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Putative conjugative transfer protein × 2 （A0A1J0HS39） DUF1788 domain-containing protein × 1 （A0A1L6KSM0） ADENOSINE-5'-TRIPHOSPHATE × 2 CALCIUM ION × 2 MAGNESIUM ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A558EY06_9GAMM
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain F； PDBConstruct 3–100； UniProt 2–99 Author chain H； PDBConstruct 3–100； UniProt 2–99

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9zll
Deposition date deposition_date	2025-12-08
Last revision last_revision	2026-04-08
Structure title title	Complex of N-terminal BrxC walker B, BrxB, and N-termianl PglZ from the Acinetobacter BREX system
Keywords keywords	Restriction, Bacteriophage, Defense, AlphaFold, ANTIMICROBIAL PROTEIN; ANTIMICROBIAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9zll__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9zll__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9zll__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	35.72 Å
Rg (electron density)	34.97 Å
Total Rg	35.32 Å
Atom count	10141
Residues	1336
Excluded volume	178020 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9zll__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9zll__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Putative conjugative transfer protein
Molecular weight formula_weight	63922.6 kDa
Mutation mutation	E269Q
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	21160

MGNIKELFYKPLDRAINGVVKADQDDNATVYQELDEYVVTNELEKHFRDFFQSYGTDLSDPSIANRVGVWISGFFGSGKSHFLKTLSYILANKVARDAEGNERSAAEFFDESKIRDAFIRADIGKAVSHHADVILFNIDSKASSNDDGNPILNVFLRVFNEYQGFSADHPHIAHMERHLSQKGVYERFKQAFEESSGMSWLEERDGYQFYQDDVETAISQALNLSAEAAHKWFEDSEQTFSVSVENFCQWVKEYLDSKGPQQRMLFLVDQVGQFIGSDTRLMLTLQTITENLGTICKGRAWIIVTSQADIDAVLGEMSSSKANDFSKIAGRFKTRLSLSSSNTDEVIQKRLLRKTPEAEALLRSVFEQKGDILKNQITFDRSGPTLKNYEGPDSFIHNYPFAPYHFQLVQKVFEEIRKVGATGAHLAYGERSMLDAFQMAANAIATDEVGALVPFHRFYTSVEGFLDTAVKRTIDQAGQNKTLDGFDVQMLRTLFMIRYVDIIKGTLDNLVTLSIEKIDEDKLALRKRIEESLQRLEKESLITRNGDEFLFLTHMENLYFQ

Source Source

Source organism organism	Acinetobacter sp. NEB 394
NCBI taxonomy ID ncbi_taxonomy_id	2743575
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	DUF1788 domain-containing protein
Molecular weight formula_weight	21901.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,G

MGSQTIHERLNQIPERILSTEFLTGQGLGNEIGFWIFDYAPEDELKVREYLHFLDGMLEKKHSQLKVVNINLLQAVVDYLAERNFIDKAIQMQKAKGDEALLKALKGPLHMDKFAPYLVSKYATNAQDIVLMTGVGSVWPLLRAHHLLNSLHSLLGHKPVVLFYPGYYDGQAMSLFGKIPSNNYYRAFRLVP

Source Source

Source organism organism	Acinetobacter sp. NEB 394
NCBI taxonomy ID ncbi_taxonomy_id	2743575
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	BREX-1 system phosphatase PglZ type A
Molecular weight formula_weight	12420.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,H

MGNLSQLQQGLEQAFFHENHRIVFWYDAEQSFTEEIKALELNDVHILNMAEESSLAIKLKLELEDQQGKYLLYFPSPEPETEKDWLLDIKLYSRSFYADRLVGPR

Source Source

Source organism organism	Acinetobacter sp. NEB 394
NCBI taxonomy ID ncbi_taxonomy_id	2743575
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 6 Entity 6 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	334

▶

Unit-cell length a length_a	149.248 Å
Unit-cell length b length_b	114.986 Å
Unit-cell length c length_c	194.050 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	108.03 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	I 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	monoclinic

Resolution resolution	2.740 Å
Low-resolution limit resolution_low	49.680 Å
R factor r_factor	0.2068
R_work r_work	0.2058
R_free r_free	0.2476

Complex of N-terminal BrxC walker B, BrxB, and N-termianl PglZ from the Acinetobacter BREX system

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative conjugative transfer protein

State in the Current Structure

Other States of the Same Protein in the Database

DUF1788 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

BREX-1 system phosphatase PglZ type A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9zll__assembly_1__model_1

9zll__assembly_1__model_1 | I(q)

9zll__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)

Complex of N-terminal BrxC walker B, BrxB, and N-termianl PglZ from the Acinetobacter BREX system

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative conjugative transfer protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DUF1788 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BREX-1 system phosphatase PglZ type A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9zll__assembly_1__model_1

9zll__assembly_1__model_1 | I(q)

9zll__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)