← Back to search

9zll

Complex of N-terminal BrxC walker B, BrxB, and N-termianl PglZ from the Acinetobacter BREX system

Method: X-RAY DIFFRACTION D_max: 170.0 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9zll
deposition_date	2025-12-08
last_revision	2026-04-08
title	Complex of N-terminal BrxC walker B, BrxB, and N-termianl PglZ from the Acinetobacter BREX system
keywords	Restriction, Bacteriophage, Defense, AlphaFold, ANTIMICROBIAL PROTEIN; ANTIMICROBIAL PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	49.50 Å
rg_electron	49.21 Å
i0	1263910000.00
molecular_weight	293870.0 kDa
excluded_volume	365810 Å³
envelope_volume	499850 Å³
shell_volume	83820 Å³
envelope_diameter	181.8 Å
shell_rg	53.73 Å
envelope_rg	48.45 Å
shape_rg	49.24 Å
total_rg	49.29 Å
total_atoms	20826
n_residues	2703
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	170.0 Å
rg_real	49.47 Å
rg_real_error	1.57 Å
i0_real	1.2640e+09
i0_real_error	2.2170e+07
rg_reciprocal	49.50 Å
i0_reciprocal	1264000000.0000
total_estimate	0.8873
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	53.1 Å
skewness	0.271
kurtosis	-0.534
angular_range	— – 0.1600 Å⁻¹
current_alpha	0.0000
highest_alpha	142300000.0000
n_real_points	33
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.860; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.994; Smooth: 0.958

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (8)

Entity 1 polymer

description	Putative conjugative transfer protein
formula_weight	63922.6 kDa
mutation	E269Q
src_method	man
entity_count	4

Polymer

type	polypeptide(L)
strand_id	A,B,C,D
atom_count	21160

MGNIKELFYKPLDRAINGVVKADQDDNATVYQELDEYVVTNELEKHFRDFFQSYGTDLSDPSIANRVGVWISGFFGSGKSHFLKTLSYILANKVARDAEGNERSAAEFFDESKIRDAFIRADIGKAVSHHADVILFNIDSKASSNDDGNPILNVFLRVFNEYQGFSADHPHIAHMERHLSQKGVYERFKQAFEESSGMSWLEERDGYQFYQDDVETAISQALNLSAEAAHKWFEDSEQTFSVSVENFCQWVKEYLDSKGPQQRMLFLVDQVGQFIGSDTRLMLTLQTITENLGTICKGRAWIIVTSQADIDAVLGEMSSSKANDFSKIAGRFKTRLSLSSSNTDEVIQKRLLRKTPEAEALLRSVFEQKGDILKNQITFDRSGPTLKNYEGPDSFIHNYPFAPYHFQLVQKVFEEIRKVGATGAHLAYGERSMLDAFQMAANAIATDEVGALVPFHRFYTSVEGFLDTAVKRTIDQAGQNKTLDGFDVQMLRTLFMIRYVDIIKGTLDNLVTLSIEKIDEDKLALRKRIEESLQRLEKESLITRNGDEFLFLTHMENLYFQ

Source

organism	Acinetobacter sp. NEB 394
ncbi_taxonomy_id	2743575
host_organism	Escherichia coli

Entity 2 polymer

description	DUF1788 domain-containing protein
formula_weight	21901.4 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	E,G

MGSQTIHERLNQIPERILSTEFLTGQGLGNEIGFWIFDYAPEDELKVREYLHFLDGMLEKKHSQLKVVNINLLQAVVDYLAERNFIDKAIQMQKAKGDEALLKALKGPLHMDKFAPYLVSKYATNAQDIVLMTGVGSVWPLLRAHHLLNSLHSLLGHKPVVLFYPGYYDGQAMSLFGKIPSNNYYRAFRLVP

Source

organism	Acinetobacter sp. NEB 394
ncbi_taxonomy_id	2743575
host_organism	Escherichia coli

Entity 3 polymer

description	BREX-1 system phosphatase PglZ type A
formula_weight	12420.9 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	F,H

MGNLSQLQQGLEQAFFHENHRIVFWYDAEQSFTEEIKALELNDVHILNMAEESSLAIKLKLELEDQQGKYLLYFPSPEPETEKDWLLDIKLYSRSFYADRLVGPR

Source

organism	Acinetobacter sp. NEB 394
ncbi_taxonomy_id	2743575
host_organism	Escherichia coli

Entity 4 non-polymer

description	ADENOSINE-5'-TRIPHOSPHATE
formula_weight	507.2 kDa
src_method	syn
entity_count	4

Entity 5 non-polymer

description	CALCIUM ION
formula_weight	40.1 kDa
src_method	syn
entity_count	6

Entity 6 non-polymer

description	CHLORIDE ION
formula_weight	35.5 kDa
src_method	syn
entity_count	1

Entity 7 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	2

Entity 8 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	334

▶

6. Citations (1)

▶

length_a	149.248 Å
length_b	114.986 Å
length_c	194.050 Å
angle_alpha	90.00 °
angle_beta	108.03 °
angle_gamma	90.00 °
z_pdb	16

space_group	I 1 2 1
int_tables_number	5
crystal_system	monoclinic

resolution	2.740 Å
resolution_low	49.680 Å
r_factor	0.2068
r_work	0.2058
r_free	0.2476

fit	/app/data/saxs_computation/zl/9zll/9zll.fit
pddf	/app/data/pr_computation/zl/9zll/9zll.pr.out
profile	/app/data/saxs_computation/zl/9zll/9zll.dat

Complex of N-terminal BrxC walker B, BrxB, and N-termianl PglZ from the Acinetobacter BREX system

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (8)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 polymer

Polymer

Source

Entity 4 non-polymer

Entity 5 non-polymer

Entity 6 non-polymer

Entity 7 non-polymer

Entity 8 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)