The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDAA7",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Modeling the ComD/ComE/comcde interaction network using small angle X-ray scattering.",
"publication": {
"title": "Modeling the ComD/ComE/comcde interaction network using small angle X-ray scattering.",
"author_list": "Sanchez D, Boudes M, van Tilbeurgh H, Durand D, Quevillon-Cheruel S",
"journal": "FEBS J",
"doi": "10.1111/febs.13240",
"pmid": "25702779",
"published_date": "2015 Apr"
},
"status": "released",
"submitted_date": "2015-01-12",
"released_date": "2015-07-07"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDAA7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDAA7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAA7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAA7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDAA7_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAA7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDAA7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "MikroGap gas detector",
"name": "VÅNTEC-2000",
"resolution": 200.0
},
"name": "IBBMC",
"city": "Orsay",
"country": "France",
"beamline_name": "Bruker Nanostar",
"beam_geometry": null,
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Histidine protein kinase",
"short_name": "ComD",
"sequence": "MEIALKQKKFEQKHLQNYIDEIVGLYNEIRGFRHDYAGMLVSMQMAIDSGNLQEIDRIYNE\r\nVLVKANHKLRSDKYTYFDLNNIEDSALRSLVAQSIVYARNNGVEFTLEVKDTITKLPIEL\r\nLDLVRIMSVLLNNAVEGSADSYKKQMEVAVIKMETETVIVIQNSCKMTMTPSGDLFALGF\r\nSTKGRNRGVGLNNVKELLDKYNNIILETEMEGSTFRQIIRFKREFEHHHHHH",
"organism": "Streptococcus pneumoniae",
"uniprot_code": "Q8DMW4",
"uniprot_range_first": 216,
"uniprot_range_last": 441,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MDLFGFGTVIVHFLIISHSYHFICKGQINRKELFVFGAYTLLTEIVFDFPLYILYLDGLG\nIERFLFPLGLYSYFRWMKQYERDRGLFLSLLLSLLYESTHNFLSVTFSSITGDNFVLQYH\nFPFFFVVTVLTYFVTLKIIYYFHLELAYFDEDYLYPFLKKVFFALLLLHIVSFVSDMVST\nIKHLNSFGSILSSIVFISLLLTFFAMNSHKVQMEKEIALKQKKFEQKHLQNYTDEIVGLY\nNEIRGFRHDYAGMLVSMQMAIDSGNLQEIDRIYNEVLVKANHKLRSDKYTYFDLNNIEDS\nALRSLVAQSIVYARNNGVEFTLEVKDTITKLPIELLDLVRIMSVLLNNAVEGSADSYKKQ\nMEVAVIKMETETVIVIQNSCKMTMTPSGDLFALGFSTKGRNRGVGLNNVKELLDKYNNII\nLETEMEGSTFRQIIRFKREFE",
"mw": 26.912,
"total_mw": 53.824,
"number_molecules": 2,
"complex_state": null,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Response regulator",
"short_name": "ComE",
"sequence": "MKVLILEDVIEHQVRLERILDEISKESNIPISYKTTGKVREFEEYIENDEVNQLYFLAID\r\nIHGIEKKGFEVAQLIRHYNPYAIIVFITSRSEFATLTYKYQVSALDFVDKDINDEMFKKR\r\nIEQNIFYTKSMLLENEDVVDYFDYNYKGNDLKIPYHDILYIETTGVSHKLRIIGKNFAKE\r\nFYGTMTDIQEKDKHTQRFYSPHKSFLVNIGNIREIDRKNLEIVFYEDHRCPISRLKIRKL\r\nKDILEKKSQKHHHHHH",
"organism": "Streptococcus pneumoniae",
"uniprot_code": "Q8DMW5",
"uniprot_range_first": 1,
"uniprot_range_last": 250,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MKVLILEDVIEHQVRLERILDEISKESNIPISYKTTGKVREFEEYIENDEVNQLYFLDID\nIHGIEKKGFEVAQLIRHYNPYAIIVFITSRSEFATLTYKYQVSALDFVDKDINDEMFKKR\nIEQNIFYTKSMLLENEDVVDYFDYNYKGNDLKIPYHDILYIETTGVSHKLRIIGKNFAKE\nFYGTMTDIQEKDKHTQRFYSPHKSFLVNIGNIREIDRKNLEIVFYEDHRCPISRLKIRKL\nKDILEKKSQK",
"mw": 30.736,
"total_mw": 61.472,
"number_molecules": 2,
"complex_state": true,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris 200 mM NaCl 5% (v/v) Glycerol 5 mM β-mercaptoethanol",
"concentration_unit": "mM",
"comment": null,
"additive": "200 mM NaCl, 5% (vol/vol) glycerol and 5 mM β-mercaptoethanol",
"concentration": 20.0,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Heterotetramer of histidine protein kinase and response regulator ",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [],
"contributor_name": "Dominique",
"contributor_surname": "Durand",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": "mg/ml",
"date": "2012-05-16",
"storage_temperature": 4.0,
"cell_temperature": 4.0,
"exposure_time": 1200.0,
"number_of_frames": 32,
"wavelength": 0.154,
"sample_detector_distance": 0.7,
"concentration_min": 0.4,
"concentration_max": 1.1,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.114,
"s_max": 4.01,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAA7_fit1_model1_img.png",
"software": "BUNCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAA7_fit1_model1.pdb",
"model_mw": 115.2,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 40
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAA7_fit1_fit_img.png",
"software": null,
"chi_square_value": 1.043758,
"p_value": 0.001974,
"fit_residual_plot": "fit4columns208_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAA7_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": "water",
"description": "Use of SAXS to describe the interaction between ComD and ComE, the two-component system which regulates the competence in S. pneumoniae.\r\nThe molecular weight is not estimated from I(0) due to the absence of tryptophan in ComE. It is obtained from the macromolecule volume by using the method developed by Craievich's team (the SAXS Mow program).",
"experiment_description": "X-ray in house radiation scattering data from solutions of the two-componentsystem ComD-ComE in 20 mM Tris 200 mM NaCl, 5% (vol/vol) glycerol and 5 mM β-mercaptoethanol were collected on the Bruker Nanostar camera (Orsay, France) using a VANTEC detector (s = 4π sin θ/λ, where 2θ is the scattering angle). Different solute concentrations in the range 0.40-1.10 mg/ml were measured. 32 successive 1200 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The scattered intensities were displayed on an absolute scale (cm-1) using the scattering by water. The low angle data collected were merged with the highest concentration high angle data to yield the final composite scattering curve.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 116.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 116.0,
"porod_mw_error": null,
"pddf_i0": 0.07508,
"pddf_i0_error": null,
"guinier_i0": 0.07466,
"guinier_i0_error": null,
"pddf_rg": 4.12,
"pddf_rg_error": null,
"guinier_rg": 3.98,
"guinier_rg_error": null,
"pddf_dmax": 16.0,
"pddf_dmax_error": null,
"porod_volume": 175.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": null,
"guinier_point_last": null,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDAA7_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDAA7",
"status": "success",
"started_at": "2026-08-11T15:25:04.517825+00:00",
"finished_at": "2026-08-11T15:25:17.876311+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDAA7/",
"path": "/data/saxsdb/sasbdb/entries/a7/sasdaa7/source/summary.json",
"size": 9092,
"sha256": "e44b3024b1deb3cb84cf2fc8f2c4229fd45530132002b9d6837103bc8888d438"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDAA7.dat",
"path": "/data/saxsdb/sasbdb/entries/a7/sasdaa7/source/SASDAA7.dat",
"size": 12538,
"sha256": "61055fef094be527fd7afd48424fb86340a936c4e0faa988ed0ddd0add988fdc",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDAA7.out",
"path": "/data/saxsdb/sasbdb/entries/a7/sasdaa7/source/SASDAA7.out",
"size": 26426,
"sha256": "5c294a04627e2b79e8ef7f2c1e9dcf65d04c87eceb43a13922e18f1a79463f7d",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDAA7.sascif",
"path": "/data/saxsdb/sasbdb/entries/a7/sasdaa7/source/SASDAA7.sascif",
"size": 868093,
"sha256": "241a0fadc9845bd00da7818e7a968eb256b6c411f3c241c54f40ab9f137a38cb",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDAA7.zip",
"path": "/data/saxsdb/sasbdb/entries/a7/sasdaa7/source/SASDAA7.zip",
"size": 150139,
"sha256": "7a8ebffea6ef02aa71ee2c53172184ccbce49e043194941a67ec45d6ba149063",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
