The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDAB8",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering.",
"publication": {
"title": "Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering.",
"author_list": "Karlsen ML, Thorsen TS, Johner N, Ammendrup-Johnsen I, Erlendsson S, Tian X, Simonsen JB, Høiberg-Nielsen R, Christensen NM, Khelashvili G, Streicher W, Teilum K, Vestergaard B, Weinstein H, Gether U, Arleth L, Madsen KL",
"journal": "Structure",
"doi": "10.1016/j.str.2015.04.020",
"pmid": "26073603",
"published_date": "2015 Jul 7"
},
"status": "released",
"submitted_date": "2015-05-10",
"released_date": "2015-07-07"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDAB8.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDAB8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAB8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAB8_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDAB8_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAB8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDAB8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "MAR 345 Image Plate",
"resolution": null
},
"name": "DORIS III, DESY",
"city": "Hamburg",
"country": "Germany",
"beamline_name": "EMBL X33",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "PRKCA-binding protein",
"short_name": null,
"sequence": "MFADLDYDIEEDKLGI\r\nPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGR\r\nSIKGKTKVEVAKMIQEVKGEVTIHYNK\r\nLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAIL\r\nCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAAS\r\nEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGPNQGGFTDGEDEEEEEEDGAAREVSKDARGATGPTDKGGSWLKV\t",
"organism": "Rattus norvegicus",
"uniprot_code": "Q9EP80",
"uniprot_range_first": 2,
"uniprot_range_last": 416,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL\nDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK\nVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL\nSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN\nKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC\nRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVSTMSKYYNDCYAVLRDADVFPI\nEVDLAHTTLAYGPNQGGFTDGEDEEEEEEDGAAREVSKDARGATGPTDKGGSWCDS",
"mw": 46.506,
"total_mw": 93.011,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Tris 125 mM NaCl 0.01 vol% reduced TX-100",
"concentration_unit": "mM",
"comment": null,
"additive": "125 mM NaCl, 0.01 vol% reduced TX-100",
"concentration": 50.0,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Protein Interacting with C-kinase 1 (PICK1) LKV, dimer contribution (data decomposition).",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Copenhagen, Denmark",
"full_name": "University of Copenhagen",
"webpage": "http://www.ku.dk/"
}
],
"contributor_name": "Morten",
"contributor_surname": "Karlsen",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": "mg/ml",
"date": "2015-05-11",
"storage_temperature": null,
"cell_temperature": 4.0,
"exposure_time": 40.0,
"number_of_frames": 4,
"wavelength": null,
"sample_detector_distance": null,
"concentration_min": 4.2,
"concentration_max": 8.8,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.068,
"s_max": 6.265,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAB8_fit1_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAB8_fit1_model1.pdb",
"model_mw": 93.76,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/logFile_101_1.log",
"symmetry": "",
"comment": "",
"user": 62
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAB8_fit1_model2_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAB8_fit1_model2.pdb",
"model_mw": 93.76,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/logFile_101_1_6r4vaCh.log",
"symmetry": "",
"comment": "",
"user": 62
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAB8_fit1_model3_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAB8_fit1_model3.pdb",
"model_mw": 93.76,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/logFile_101_1_2Ai52bk.log",
"symmetry": "",
"comment": "",
"user": 62
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAB8_fit1_fixed_fit_img.png",
"software": null,
"chi_square_value": 3.82,
"p_value": 0.0,
"fit_residual_plot": null,
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAB8_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": "BSA",
"description": "Structure and flexibility of PICK1 LKV mutant dimer was characterized by SAXS using data obtained by decomposing scattering from two polydisperse samples into dimer (and tetramer) contributions. To obtain the dimer scattering, two samples were measured at 4.4 and 8,8 mg/ml, and decomposed as described in the reference. Models were fitted to data using a combination of rigid body modelling and EOM, based on structural components defined by NMR and MD simulations. PDB files represent structures found in the optimal ensemble. \r\n\r\nAll data, in addition to that displayed for this entry, are available in the .zip archive.",
"experiment_description": null,
"tags": [
"X33"
],
"intensity_unit": null,
"experimental_mw": 92.0,
"experimental_mw_error": null,
"guinier_i0_mw": 92.0,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 1.029,
"pddf_i0_error": 0.01,
"guinier_i0": 1.07,
"guinier_i0_error": 0.01,
"pddf_rg": 6.03,
"pddf_rg_error": 0.05,
"guinier_rg": 6.017,
"guinier_rg_error": 0.91,
"pddf_dmax": 20.0,
"pddf_dmax_error": null,
"porod_volume": 205.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 13,
"guinier_point_last": 34,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": "https://www.sasbdb.org/media/standard_curves/bsa_108_3-70mg.dat",
"intensities_log_log_plot": "SASDAB8_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-05-25T11:22:16.556436+02:00",
"bragg_peak": []
}
