The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDAB9",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "A unique hetero-hexadecameric architecture displayed by the Escherichia coli O157 PaaA2-ParE2 antitoxin-toxin complex.",
"publication": {
"title": "A unique hetero-hexadecameric architecture displayed by the Escherichia coli O157 PaaA2-ParE2 antitoxin-toxin complex.",
"author_list": "Sterckx YG, Jové T, Shkumatov AV, Garcia-Pino A, Geerts L, De Kerpel M, Lah J, De Greve H, Van Melderen L, Loris R",
"journal": "J Mol Biol",
"doi": "10.1016/j.jmb.2016.03.007",
"pmid": "26996937",
"published_date": "2016 Apr 24"
},
"status": "released",
"submitted_date": "2015-08-24",
"released_date": "2016-03-18"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDAB9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDAB9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAB9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAB9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDAB9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAB9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDAB9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "CCD",
"name": "AVIEX PCCD170170",
"resolution": null
},
"name": "SOLEIL",
"city": "Saint-Aubin",
"country": "France",
"beamline_name": "SWING",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Plasmid stabilization protein ParE",
"short_name": "EcParE2",
"sequence": "MGSSHHHHHHSSGLVPRGSHLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVEVVNVIHARRQFP",
"organism": "Escherichia coli",
"uniprot_code": "A0A0D7C2L1",
"uniprot_range_first": 2,
"uniprot_range_last": 92,
"oligomerization": "octamer",
"molecular_type": "protein",
"uniprot_sequence": "MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLR\nEIVAHPNYIILYRVTTSSVEVVNVIHARRQFP",
"mw": 12.693,
"total_mw": 101.546,
"number_molecules": 8,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Uncharacterized protein (Antitoxin)",
"short_name": "EcPaaA2",
"sequence": "MDYKDDDDKNRALSPMVSEFETIEQENSYNEWLRAKVATSLADPRPAIPHDEVERRMAERFAKMRKERSKQ",
"organism": "Escherichia coli",
"uniprot_code": "A0A0F6F6Q9",
"uniprot_range_first": 14,
"uniprot_range_last": 75,
"oligomerization": "octamer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 8.458,
"total_mw": 67.667,
"number_molecules": 8,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Tris-HCl 500 mM NaCl",
"concentration_unit": "mM",
"comment": null,
"additive": "500 mM NaCl",
"concentration": 50.0,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "EcPaaA2-HisEcParE2 construct",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "VUB",
"address": "Pleinlaan 2 1050 Brussel ",
"full_name": "Vrije Universiteit Brussel",
"webpage": "http://www.vub.ac.be/"
}
],
"contributor_name": "Alexander",
"contributor_surname": "Shkumatov",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": "mg/ml",
"date": "2012-02-05",
"storage_temperature": null,
"cell_temperature": 10.0,
"exposure_time": 0.75,
"number_of_frames": 750,
"wavelength": 0.1,
"sample_detector_distance": 1.82,
"concentration_min": 1.0,
"concentration_max": 10.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.222,
"s_max": 4.003,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAB9_fit1_model1_img.png",
"software": "CRYSOL",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAB9_fit1_model1.pdb",
"model_mw": 84.58,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "NMA refinement",
"user": 104
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAB9_fit1_fit_img.png",
"software": null,
"chi_square_value": 3.439,
"p_value": 0.0,
"fit_residual_plot": null,
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAB9_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAB9_fit2_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAB9_fit2_model1.pdb",
"model_mw": 94.15,
"bead_radius": 3.5,
"log": null,
"symmetry": "",
"comment": "",
"user": 104
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAB9_fit2_fit_img.png",
"software": null,
"chi_square_value": 1.726,
"p_value": 0.0,
"fit_residual_plot": "SASDAB9_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAB9_fit2.fir",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "Use of SAXS to validate the oligomer state of the obtained crystal structure and to model missing afinity tags",
"experiment_description": null,
"tags": [],
"intensity_unit": null,
"experimental_mw": 100.0,
"experimental_mw_error": null,
"guinier_i0_mw": 100.0,
"guinier_i0_mw_error": null,
"porod_mw": 97.74,
"porod_mw_error": null,
"pddf_i0": 0.18,
"pddf_i0_error": null,
"guinier_i0": 0.175042,
"guinier_i0_error": null,
"pddf_rg": 3.408,
"pddf_rg_error": null,
"guinier_rg": 3.255,
"guinier_rg_error": null,
"pddf_dmax": 15.28,
"pddf_dmax_error": null,
"porod_volume": 166.16,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": null,
"guinier_point_last": null,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDAB9_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}
