The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDAE7",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Crystal Structure of the CTP1L Endolysin Reveals How Its Activity Is Regulated by a Secondary Translation Product.",
"publication": {
"title": "Crystal Structure of the CTP1L Endolysin Reveals How Its Activity Is Regulated by a Secondary Translation Product.",
"author_list": "Dunne M, Leicht S, Krichel B, Mertens HD, Thompson A, Krijgsveld J, Svergun DI, Gómez-Torres N, Garde S, Uetrecht C, Narbad A, Mayer MJ, Meijers R",
"journal": "J Biol Chem",
"doi": "10.1074/jbc.M115.671172",
"pmid": "26683375",
"published_date": "2016 Mar 4"
},
"status": "released",
"submitted_date": "2015-01-19",
"released_date": "2016-03-17"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDAE7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDAE7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAE7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAE7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDAE7_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAE7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDAE7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Custom-built",
"name": "Pilatus 1M-W",
"resolution": 0.172
},
"name": "DORIS III, DESY",
"city": "Hamburg",
"country": "Germany",
"beamline_name": "EMBL X33",
"beam_geometry": "0.60",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Endolysin CS74L ",
"short_name": "CS74L",
"sequence": "MGSSHHHHHHSSGLVPRGSHMKIGIDMGHTLSGADYGVVGLRPESVLTREVGTKVIYKLQ KLGHVVVNCTVDKASSVSESLYTRYYRANQANVDLFISIHFNATPGGTGTEVYTYAGRQL GEATRIRQEFKSLGLRDRGTKDGSGLAVIRNTKAKAMLVECCFCDNPNDMKLYNSESFSN AIVKGITGKLPNGESGNNNQGGNKVKAVVIYNEGADRRGAEYLADYLNCPTISNSRTFDY SCVEHVYAVGGKKEQYTKYLKTLLSGANRYDTMQQILNFINGGK",
"organism": "Clostridium phage phi8074-B1",
"uniprot_code": "I1TJX3",
"uniprot_range_first": 1,
"uniprot_range_last": 264,
"oligomerization": "other",
"molecular_type": "protein",
"uniprot_sequence": "MKIGIDMGHTLSGADYGVVGLRPESVLTREVGTKVIYKLQKLGHVVVNCTVDKASSVSES\nLYTRYYRANQANVDLFISIHFNATPGGTGTEVYTYAGRQLGEATRIRQEFKSLGLRDRGT\nKDGSGLAVIRNTKAKAMLVECCFCDNPNDMKLYNSESFSNAIVKGITGKLPNGESGNNNQ\nGGNKVKAVVIYNEGADRRGAEYLADYLNCPTISNSRTFDYSCVEHVYAVGGKKEQYTKYL\nKTLLSGANRYDTMQQILNFINGGK",
"mw": 31.1,
"total_mw": 31.1,
"number_molecules": 0,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM HEPES",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Structure of a complex between full length and truncated CS74L endolysin",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Haydyn",
"contributor_surname": "Mertens",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2011-03-17",
"storage_temperature": null,
"cell_temperature": 20.0,
"exposure_time": 15.0,
"number_of_frames": 8,
"wavelength": 0.15,
"sample_detector_distance": 2.7,
"concentration_min": 1.0,
"concentration_max": 6.8,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.163,
"s_max": 6.024,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAE7_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAE7_fit1_model1.pdb",
"model_mw": 53.95,
"bead_radius": 3.0,
"log": null,
"symmetry": "",
"comment": "",
"user": 12
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAE7_fit1_fit_img.png",
"software": null,
"chi_square_value": 1.45,
"p_value": 0.711652,
"fit_residual_plot": "SASDAE7_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAE7_fit1.fir",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAE7_fit2_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "2.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAE7_fit2_model1.pdb",
"model_mw": 80.9,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "Ensemble Component: Heterotetramer (compact)",
"user": 12
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAE7_fit2_model2_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAE7_fit2_model2.pdb",
"model_mw": 80.9,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "Ensemble Component: Heterotetramer (extended)",
"user": 12
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAE7_fit2_model3_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "2.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAE7_fit2_model3.pdb",
"model_mw": 8.893,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "Ensemble Component: Free CTD of endolysin",
"user": 12
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAE7_fit2_fit_img.png",
"software": null,
"chi_square_value": 0.664,
"p_value": 0.051,
"fit_residual_plot": "fit4columns214_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAE7_fit2.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [
"X33"
],
"intensity_unit": null,
"experimental_mw": 38.4,
"experimental_mw_error": null,
"guinier_i0_mw": 38.4,
"guinier_i0_mw_error": null,
"porod_mw": 49.5,
"porod_mw_error": null,
"pddf_i0": 51.9,
"pddf_i0_error": null,
"guinier_i0": 50.3,
"guinier_i0_error": null,
"pddf_rg": 3.8,
"pddf_rg_error": null,
"guinier_rg": 3.6,
"guinier_rg_error": null,
"pddf_dmax": 14.0,
"pddf_dmax_error": null,
"porod_volume": 79.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": null,
"guinier_point_last": null,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDAE7_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-05-25T11:21:52.654103+02:00",
"bragg_peak": []
}
