The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDAQ7",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "The flexibility of a homeodomain transcription factor heterodimer and its allosteric regulation by DNA binding.",
"publication": {
"title": "The flexibility of a homeodomain transcription factor heterodimer and its allosteric regulation by DNA binding.",
"author_list": "Mathiasen L, Valentini E, Boivin S, Cattaneo A, Blasi F, Svergun DI, Bruckmann C",
"journal": "FEBS J",
"doi": "10.1111/febs.13801",
"pmid": "27390177",
"published_date": "2016 Aug"
},
"status": "released",
"submitted_date": null,
"released_date": "2016-07-25"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDAQ7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDAQ7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAQ7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAQ7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDAQ7_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAQ7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDAQ7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Pre-B-cell leukemia transcription factor 1",
"short_name": "PBX1",
"sequence": "MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDE\r\nAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGP\r\nEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVM\r\nNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNF\r\nNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQE\r\nEANIYAAK",
"organism": "Homo sapiens",
"uniprot_code": "P40424",
"uniprot_range_first": 1,
"uniprot_range_last": 308,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDE\nAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGP\nEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVM\nNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNF\nNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQE\nEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQG\nAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEG\nPGSVHSDTSN",
"mw": 34.455,
"total_mw": 34.455,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Homeobox protein PKNOX1",
"short_name": "PREP1",
"sequence": "MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYR\r\nHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKEGKPFFCEDPETDNLMVK\r\nAIQVLRIHLLELEKVNELCKDFCSRYIACLKTEMNSETLLSGEPGSPYSPVQSQQIQSAI\r\nTGTISPQGIVVPASALQQGNVAMATVAGGTVYQPVTVVTPQGQVVTQTLSPGTIRIQNSQ\r\nLQLQLNQDLSILHQDDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTN\r\nLTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKTAQNRPVQRF",
"organism": "Homo sapiens",
"uniprot_code": "P55347",
"uniprot_range_first": 1,
"uniprot_range_last": 344,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYR\nHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKEGKPFFCEDPETDNLMVK\nAIQVLRIHLLELEKVNELCKDFCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQQIQSAI\nTGTISPQGIVVPASALQQGNVAMATVAGGTVYQPVTVVTPQGQVVTQTLSPGTIRIQNSQ\nLQLQLNQDLSILHQDDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTN\nLTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKTAQNRPVQRFWPDSIASGVAQPPPS\nELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALA\nPAHISGLVLENSDSLQ",
"mw": 38.339,
"total_mw": 38.339,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "DNA 22mer",
"short_name": null,
"sequence": "5'-GCCTAGTGATTGACAGATTCCT-3'",
"organism": null,
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "DNA",
"uniprot_sequence": null,
"mw": 11.9,
"total_mw": 11.9,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris-HCl 150 mM NaCl 5% glycerol 1 mM DTT",
"concentration_unit": "mM",
"comment": null,
"additive": "150 mM NaCl, 5% glycerol, 1 mM DTT",
"concentration": 20.0,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "PBX1-PREB1-DNA complex",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Erica",
"contributor_surname": "Valentini",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": "mg/ml",
"date": "2013-12-06",
"storage_temperature": null,
"cell_temperature": null,
"exposure_time": null,
"number_of_frames": null,
"wavelength": 0.12,
"sample_detector_distance": 3.1,
"concentration_min": null,
"concentration_max": 3.8,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.028,
"s_max": 4.45,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAQ7_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAQ7_fit1_model1.pdb",
"model_mw": null,
"bead_radius": 3.75,
"log": null,
"symmetry": "",
"comment": "",
"user": 1
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAQ7_fit1_fit_img.png",
"software": null,
"chi_square_value": 1.138489,
"p_value": 0.133933,
"fit_residual_plot": "SASDAQ7_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAQ7_fit1.fir",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAQ7_fit2_model1_img.png",
"software": "MONSA",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAQ7_fit2_model1.pdb",
"model_mw": null,
"bead_radius": 5.25,
"log": null,
"symmetry": "",
"comment": "",
"user": 1
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAQ7_fit2_fit_img.png",
"software": null,
"chi_square_value": 1.098304,
"p_value": 0.214136,
"fit_residual_plot": "SASDAQ7_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAQ7_fit2.fit",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAQ7_fit3_fit_img.png",
"software": null,
"chi_square_value": 1.065024,
"p_value": 0.624368,
"fit_residual_plot": "SASDAQ7_fit3_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAQ7_fit3.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": null,
"experimental_mw": 80.0,
"experimental_mw_error": null,
"guinier_i0_mw": 80.0,
"guinier_i0_mw_error": null,
"porod_mw": 136.0,
"porod_mw_error": null,
"pddf_i0": 1613.0,
"pddf_i0_error": null,
"guinier_i0": 1640.0,
"guinier_i0_error": null,
"pddf_rg": 4.8,
"pddf_rg_error": null,
"guinier_rg": 4.8,
"guinier_rg_error": null,
"pddf_dmax": 16.3,
"pddf_dmax_error": null,
"porod_volume": 173.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 15,
"guinier_point_last": 94,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDAQ7_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}
