The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDAW8",
"status": "Published",
"type_of_curve": "Extrapolated to infinite dilution",
"angular_unit": "1/nm",
"project": {
"title": "Immunosuppressive Yersinia Effector YopM Binds DEAD Box Helicase DDX3 to Control Ribosomal S6 Kinase in the Nucleus of Host Cells.",
"publication": {
"title": "Immunosuppressive Yersinia Effector YopM Binds DEAD Box Helicase DDX3 to Control Ribosomal S6 Kinase in the Nucleus of Host Cells.",
"author_list": "Berneking L, Schnapp M, Rumm A, Trasak C, Ruckdeschel K, Alawi M, Grundhoff A, Kikhney AG, Koch-Nolte F, Buck F, Perbandt M, Betzel C, Svergun DI, Hentschke M, Aepfelbacher M",
"journal": "PLoS Pathog",
"doi": "10.1371/journal.ppat.1005660",
"pmid": "27300509",
"published_date": "2016 Jun"
},
"status": "released",
"submitted_date": "2015-07-06",
"released_date": "2016-06-14"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDAW8.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDAW8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAW8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAW8_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDAW8_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAW8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDAW8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Yersinia outer protein M (34-481)",
"short_name": "YopM",
"sequence": "KSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLERLVASCNSLTELPELPQSL\r\nKSLEVYENNLKALPDLPPLLVDLRVFNNQLEELPELQNLPFLTEIYANNNSLKTLPDLPPSLVDLNVRENYLTALPELPQ\r\nSLIFLDISDNILSGLSELPPNLSCLDASRNGIRSLCDLPPSLVYLDVRDNQLIELPALPSGLERLIASFNHLAELPELPP\r\nNLYYLDASRNEISSLCDLPPSLVDLNVRKNQLIELPALPPDLERLIASFNHLAELPELPPNLSYLDASRNEISSLCDLPP\r\nSLVDLNVRKNQLIELPALPPDLERLIASFNHLAELPELPPNLSYLDASRNEISSLCDLPPSLVELDVRDNQLIELPALPP\r\nHLERLIASLNHLAEVPELPQNLKQLHVEHNALREFPDIPESVEDLRMD",
"organism": "Yersinia enterocolitica",
"uniprot_code": null,
"uniprot_range_first": 34,
"uniprot_range_last": 481,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 50.321,
"total_mw": 100.643,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "DEAD box RNA helicase DDX3 (51-418)",
"short_name": "DDX3",
"sequence": null,
"organism": "Yersinia enterocolitica",
"uniprot_code": null,
"uniprot_range_first": 51,
"uniprot_range_last": 418,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 41.5,
"total_mw": 41.5,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM HEPES 150 mM NaCl",
"concentration_unit": "mM",
"comment": null,
"additive": "150 mM NaCl",
"concentration": 50.0,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "2:1 YopM:DDX3 complex",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": false
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Al",
"contributor_surname": "Kikhney",
"orcid": "https://orcid.org/0000-0003-1321-3956"
}
],
"concentration_method": null,
"concentration_unit": "mg/ml",
"date": "2013-06-14",
"storage_temperature": 23.0,
"cell_temperature": 23.0,
"exposure_time": 0.05,
"number_of_frames": 20,
"wavelength": 0.12,
"sample_detector_distance": 3.1,
"concentration_min": 0.66,
"concentration_max": 10.6,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.077,
"s_max": 4.583,
"total_exposure_time": 1.0,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAW8_fit1_model1_img.png",
"software": "SASREF",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAW8_fit1_model1.pdb",
"model_mw": 142.0,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 4
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAW8_fit1_fit_img.png",
"software": null,
"chi_square_value": 1.547,
"p_value": 0.0,
"fit_residual_plot": "SASDAW8_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAW8_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAW8_fit2_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "r5577",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAW8_fit2_model1.pdb",
"model_mw": 123.0,
"bead_radius": 3.1,
"log": "https://www.sasbdb.org/media/log_files/Hepes_zc_5.log",
"symmetry": "",
"comment": "",
"user": 4
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAW8_fit2_fit_img.png",
"software": null,
"chi_square_value": 1.344,
"p_value": 0.145237,
"fit_residual_plot": "SASDAW8_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAW8_fit2.fir",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "A complex composed of two YopM_34-481 molecules and one DDX3_51-418",
"experiment_description": null,
"tags": [],
"intensity_unit": null,
"experimental_mw": 123.0,
"experimental_mw_error": 12.0,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 119.0,
"porod_mw_error": 12.0,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 7459.0,
"guinier_i0_error": null,
"pddf_rg": 4.033,
"pddf_rg_error": null,
"guinier_rg": 3.97,
"guinier_rg_error": 0.12,
"pddf_dmax": 15.0,
"pddf_dmax_error": 1.5,
"porod_volume": 189.7,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 15,
"guinier_point_last": 95,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDAW8_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}
