The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDAY4",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "The central portion of factor H (modules 10-15) is compact and contains a structurally deviant CCP module.",
"publication": {
"title": "The central portion of factor H (modules 10-15) is compact and contains a structurally deviant CCP module.",
"author_list": "Schmidt CQ, Herbert AP, Mertens HD, Guariento M, Soares DC, Uhrin D, Rowe AJ, Svergun DI, Barlow PN",
"journal": "J Mol Biol",
"doi": "10.1016/j.jmb.2009.10.010",
"pmid": "19835885",
"published_date": "2010 Jan 8"
},
"status": "released",
"submitted_date": null,
"released_date": "2015-07-07"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDAY4.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDAY4.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAY4_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAY4_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDAY4_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDAY4_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDAY4.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "MAR 345 Image Plate",
"resolution": null
},
"name": "DORIS III, DESY",
"city": "Hamburg",
"country": "Germany",
"beamline_name": "EMBL X33",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Factor H CCP modules 10 to 15",
"short_name": "fH1015",
"sequence": "AGECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKE\r\nQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCI\r\nVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCV\r\nAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSM\r\nAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCV\r\nEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQ\r\nCE",
"organism": "Homo sapiens",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 40.9,
"total_mw": 40.9,
"number_molecules": 1,
"complex_state": null,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Potassium Phosphate",
"concentration_unit": "mM",
"comment": null,
"additive": null,
"concentration": 50.0,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "fH1015",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Haydyn",
"contributor_surname": "Mertens",
"orcid": null
}
],
"concentration_method": "A280",
"concentration_unit": "mg/ml",
"date": "2008-12-02",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 120.0,
"number_of_frames": 1,
"wavelength": null,
"sample_detector_distance": null,
"concentration_min": 2.4,
"concentration_max": 10.5,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.211,
"s_max": 4.786,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAY4_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAY4_fit1_model1.pdb",
"model_mw": 34.0,
"bead_radius": 2.2,
"log": "https://www.sasbdb.org/media/log_files/fh1015w_5.log",
"symmetry": "",
"comment": "",
"user": 12
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAY4_fit1_fit_img.png",
"software": null,
"chi_square_value": 1.716798,
"p_value": 0.0,
"fit_residual_plot": "SASDAY4_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAY4_fit1.fir",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAY4_fit2_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAY4_fit2_model1.pdb",
"model_mw": null,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/fh1015g3.log",
"symmetry": "",
"comment": "",
"user": 12
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAY4_fit2_fit_img.png",
"software": null,
"chi_square_value": 1.0609,
"p_value": 0.0,
"fit_residual_plot": "SASDAY4_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAY4_fit2.fir",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAY4_fit3_model1_img.png",
"software": "BUNCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAY4_fit3_model1.pdb",
"model_mw": 40.96,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/fh1015.log",
"symmetry": "",
"comment": "alternative model 1",
"user": 12
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAY4_fit3_fit_img.png",
"software": null,
"chi_square_value": 9.229444,
"p_value": 0.0,
"fit_residual_plot": "fit4columns81_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAY4_fit3.fit",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDAY4_fit4_model1_img.png",
"software": "BUNCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDAY4_fit4_model1.pdb",
"model_mw": 40.96,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/fh1015_1.log",
"symmetry": "",
"comment": "alternative model 2",
"user": 12
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDAY4_fit4_fit_img.png",
"software": null,
"chi_square_value": 6.170256,
"p_value": 0.0,
"fit_residual_plot": "fit4columns82_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDAY4_fit4.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": "BSA",
"description": null,
"experiment_description": null,
"tags": [
"X33"
],
"intensity_unit": null,
"experimental_mw": 46.0,
"experimental_mw_error": null,
"guinier_i0_mw": 46.0,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 1.62,
"guinier_i0_error": null,
"pddf_rg": 3.1,
"pddf_rg_error": null,
"guinier_rg": 3.0,
"guinier_rg_error": null,
"pddf_dmax": 10.4,
"pddf_dmax_error": null,
"porod_volume": 68.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 98,
"pddf_point_first": 1,
"pddf_point_last": 1000,
"i0_calibration_standard_data": "https://www.sasbdb.org/media/standard_curves/bsa_020.dat",
"intensities_log_log_plot": "SASDAY4_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-05-25T11:22:16.556436+02:00",
"bragg_peak": []
}
