The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDB65",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Global Disordering in Stereo-Specific Protein Association",
"publication": {
"title": "Global Disordering in Stereo-Specific Protein Association",
"author_list": "Gupta A, Reinartz I, Spilotros A, Jonna V, Hofer A, Svergun D, Schug A, Wolf-Watz M",
"journal": "Biophysical Journal",
"doi": "10.1016/j.bpj.2016.11.211",
"pmid": null,
"published_date": "2017 Feb"
},
"status": "released",
"submitted_date": "2016-08-12",
"released_date": "2017-04-21"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDB65.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDB65.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB65_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB65_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDB65_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB65_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDB65.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "SycH putative yopH targeting protein",
"short_name": "SycH",
"sequence": "MRTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINEKELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGTQLASVLTSLVDKAVTLSCEPTMKKEEDDHRPSSSHLLV",
"organism": "Yersinia pseudotuberculosis",
"uniprot_code": "I3NIC8",
"uniprot_range_first": 1,
"uniprot_range_last": 141,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MRTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINEKELVAFMRAGILTGQ\nSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGTQLASVLTSLVDKAVTLS\nCEPTMKKEEDDHRPSSSHLLV",
"mw": 15.763,
"total_mw": 31.526,
"number_molecules": 2,
"complex_state": null,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Tyrosine-protein phosphatase YopH",
"short_name": "YopH",
"sequence": "MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARESEKVFAQTVLSHVANVVLTQEDTAKLLQST\r\nVKHNLNNYDLRSVGNGNSVLVSLRSDQMTLQDAKVLLEAALRQESGARG",
"organism": "Yersinia pseudotuberculosis",
"uniprot_code": "P08538",
"uniprot_range_first": 1,
"uniprot_range_last": 129,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARESEKVFAQTVL\nSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVSLRSDQMTLQDAKVLLEAA\nLRQESGARGHVSSHSHSALHAPGTPVREGLRSHLDPRTPPLPPRERPHTSGHHGAGEARA\nTAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACGGEKLNRFRDIQCCRQTAV\nRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPVLAVLASSSEIANQRFGMPD\nYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAGQKTISVPVVHVGNWPDQTAV\nSSEVTKALASLVDQTAETKRNMYESKGSSAVGDDSKLRPVIHCRAGVGRTAQLIGAMCMN\nDSRNSQLSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLAEGQGRPLLNS",
"mw": 13.95,
"total_mw": 13.95,
"number_molecules": 1,
"complex_state": null,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM HEPES 2mM TCEP",
"concentration_unit": "mM",
"comment": null,
"additive": "2mM TCEP",
"concentration": 50.0,
"pka": null,
"ph": 6.8,
"deuteration": null
},
"purity_method": null,
"name": "Tyrosine-protein phosphatase (YopH)/putative yopH targeting protein (SycH) heterotrimeric complex",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Alessandro",
"contributor_surname": "Spilotros",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": "mg/ml",
"date": "2016-08-01",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.05,
"number_of_frames": 20,
"wavelength": 0.12,
"sample_detector_distance": 3.1,
"concentration_min": null,
"concentration_max": 1.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.066,
"s_max": 4.808,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB65_fit1_model1_img.png",
"software": "CRYSOL",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDB65_fit1_model1.pdb",
"model_mw": 45.45,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 109
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDB65_fit1_fit_img.png",
"software": null,
"chi_square_value": 1.27,
"p_value": 0.0,
"fit_residual_plot": "fit4columns464_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDB65_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "X-ray synchrotron radiation scattering data from a solution of dimeric YopH protein in complex with the tyrosine-protein phosphatase, SycH, in 50 mM HEPES, 2 mM TCEP, pH 6.8 were collected on the P12 beam line of Petra-III (Hamburg, Germany) using a Pilatus 2M detector (I(s) vs s; s = 4π sin θ/λ, where 2θ is the scattering angle and λ=0.12 nm). One solute concentration of 1.00 mg/ml was measured using an exposure time of 1 s (recorded as 20 x 0.050 s frames). The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering from the matched solvent-blank was subtracted. The data were scaled to protein concentration. The results presented here were obtained from a single concentration scattering curve.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 52.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 55.8,
"porod_mw_error": null,
"pddf_i0": 74550.0,
"pddf_i0_error": 130.0,
"guinier_i0": 74475.0,
"guinier_i0_error": 117.0,
"pddf_rg": 3.01,
"pddf_rg_error": 0.013,
"guinier_rg": 2.96,
"guinier_rg_error": 0.13,
"pddf_dmax": 12.5,
"pddf_dmax_error": null,
"porod_volume": 89.2,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 22,
"guinier_point_last": 115,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDB65_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDB65",
"status": "success",
"started_at": "2026-08-11T14:39:38.470285+00:00",
"finished_at": "2026-08-11T14:39:48.120805+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDB65/",
"path": "/data/saxsdb/sasbdb/entries/65/sasdb65/source/summary.json",
"size": 8612,
"sha256": "86ee490a277f88a5f6fd831ac0fcbfb56dea9e335070490eb7a79930041fbdf8"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDB65.dat",
"path": "/data/saxsdb/sasbdb/entries/65/sasdb65/source/SASDB65.dat",
"size": 82964,
"sha256": "85b2052cf15c5593e8f5425c54f5c3891ff6b12a8efeac073960e6c729074107",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDB65.out",
"path": "/data/saxsdb/sasbdb/entries/65/sasdb65/source/SASDB65.out",
"size": 110136,
"sha256": "37233c3b306939f9e2a5c29bfb6f64e6de501d9544760feef1a1d891cfdfad85",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDB65.sascif",
"path": "/data/saxsdb/sasbdb/entries/65/sasdb65/source/SASDB65.sascif",
"size": 582537,
"sha256": "950f946eca60fe1744a13c8039f3a11f9c03f509c756167b0377ff487c7f7bce",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDB65.zip",
"path": "/data/saxsdb/sasbdb/entries/65/sasdb65/source/SASDB65.zip",
"size": 165512,
"sha256": "89cd24e03d4d8ca652a857ddc98034ec2ba90d3379a08ffd5520c78dc481032a",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
