The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDB72",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Death-Associated Protein Kinase Activity Is Regulated by Coupled Calcium/Calmodulin Binding to Two Distinct Sites.",
"publication": {
"title": "Death-Associated Protein Kinase Activity Is Regulated by Coupled Calcium/Calmodulin Binding to Two Distinct Sites.",
"author_list": "Simon B, Huart AS, Temmerman K, Vahokoski J, Mertens HD, Komadina D, Hoffmann JE, Yumerefendi H, Svergun DI, Kursula P, Schultz C, McCarthy AA, Hart DJ, Wilmanns M",
"journal": "Structure",
"doi": "10.1016/j.str.2016.03.020",
"pmid": "27133022",
"published_date": "2016 Jun 7"
},
"status": "released",
"submitted_date": "2015-09-24",
"released_date": "2015-09-24"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDB72.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDB72.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB72_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB72_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDB72_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB72_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDB72.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Death associated protein kinase (Basic Loop mutant)",
"short_name": "hDAPK2 BL mutant",
"sequence": "GPMSEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKEQSEASEEGVS\r\nREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEAT\r\nSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNI\r\nFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITSVSYDFD\r\nEEFFSHTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDNQQAMVRRESVVNLENFR\r\nKQYVRRRWKLSFSIVSLCNHLTR",
"organism": "Homo sapiens",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "other",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 37.3,
"total_mw": 37.3,
"number_molecules": 0,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM HEPES 250 mM NaCl 5mM CaCl2 0.25 mM TCEP 5% (v/v) glycerol",
"concentration_unit": "mM",
"comment": null,
"additive": "250 mM NaCl, 5mM CaCl2, 0.25 mM TCEP, 5% [v/v] glycerol",
"concentration": 50.0,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Death associated protein kinase (Basic Loop mutant)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": 45000,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Haydyn",
"contributor_surname": "Mertens",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": "mg/ml",
"date": "2013-12-18",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 0.05,
"number_of_frames": 20,
"wavelength": 0.12,
"sample_detector_distance": 3.1,
"concentration_min": null,
"concentration_max": 2.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.028,
"s_max": 4.45,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/2a2a_abr_TVbCSYc_img.png",
"software": "OLIGOMER",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDB72_fit1_model1.pdb",
"model_mw": 69.98,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "Dimer component PDB 2A2A:AB",
"user": 12
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/2a2a_a_B5zipUX_img.png",
"software": "OLIGOMER",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDB72_fit1_model2.pdb",
"model_mw": 35.06,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "Monomer component PDB 2A2A:A",
"user": 12
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDB72_fit1_fit_img.png",
"software": null,
"chi_square_value": 1.06,
"p_value": 0.048315,
"fit_residual_plot": "SASDB72_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDB72_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "GNOM",
"i0_calibration_standard": null,
"description": "Characterisation of mutation of basic loop residues (R47E, R50E, R53E, R54E) on dimer formation of hDAPK2",
"experiment_description": null,
"tags": [],
"intensity_unit": null,
"experimental_mw": 32.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 46.0,
"porod_mw_error": null,
"pddf_i0": 617.0,
"pddf_i0_error": null,
"guinier_i0": 623.0,
"guinier_i0_error": null,
"pddf_rg": 2.3,
"pddf_rg_error": null,
"guinier_rg": 2.4,
"guinier_rg_error": null,
"pddf_dmax": 7.5,
"pddf_dmax_error": null,
"porod_volume": 78.0,
"porod_volume_error": null,
"estimated_volume": 45000.0,
"estimated_volume_error": null,
"guinier_point_first": 48,
"guinier_point_last": 189,
"pddf_point_first": 48,
"pddf_point_last": 1274,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDB72_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDB72",
"status": "success",
"started_at": "2026-08-11T13:31:51.324340+00:00",
"finished_at": "2026-08-11T13:32:01.217923+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDB72/",
"path": "/data/saxsdb/sasbdb/entries/72/sasdb72/source/summary.json",
"size": 7570,
"sha256": "016a04a93c1ebf3e251dba7177cb0ae1961a166f7af4c72b07c0afce1fe68772"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDB72.dat",
"path": "/data/saxsdb/sasbdb/entries/72/sasdb72/source/SASDB72.dat",
"size": 75979,
"sha256": "cd59a62228e9c1293f383ba538e76a7939bb8f794d1fdd7dafc4429eb24fbe26",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDB72.out",
"path": "/data/saxsdb/sasbdb/entries/72/sasdb72/source/SASDB72.out",
"size": 101637,
"sha256": "0d53b096e2d9091eeeeaf03e477a46ece8eff63ade3e14b720e3147d95439885",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDB72.sascif",
"path": "/data/saxsdb/sasbdb/entries/72/sasdb72/source/SASDB72.sascif",
"size": 1004720,
"sha256": "2ada884dcc7a71533b79d9f7f87a5c545c2b5852a7b134fedb0b33e43b44443b",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDB72.zip",
"path": "/data/saxsdb/sasbdb/entries/72/sasdb72/source/SASDB72.zip",
"size": 219331,
"sha256": "302bd9d4926050d2f679c775c7c03df50080d4cb1d6ad8fd6a9adc66b967b7d4",
"role": "full_entry_zip",
"zip_member_count": 5,
"zip_validation": "central_directory_readable"
}
]
}
