Self-processing module of iron-regulated protein FrpC (415-591)

{
  "code": "SASDB85",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Self-processing module of Iron-regulated protein FrpC",
    "publication": null,
    "status": "released",
    "submitted_date": "2016-08-16",
    "released_date": "2021-09-13"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDB85.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDB85.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB85_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB85_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDB85_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB85_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDB85.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 100K",
        "resolution": 172.0
      },
      "name": "CEITEC",
      "city": "Brno",
      "country": "Czech Republic",
      "beamline_name": "Rigaku BioSAXS-1000",
      "beam_geometry": "",
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Iron-regulated protein FrpC (amino acids 415-591)",
          "short_name": "FrpC:415-591",
          "sequence": "PLALDLDGDGIETVATKGFSGSLFDHNRDGIRTATGWVSADDGLLVRDLNGNGIIDNGAELF\r\nGDNTKLADGSFAKHGYAALAELDSNGDNIINAADAAFQSLRVWQDLNQDGISQANELRTL\r\nEELGIQSLDLAYKDVNKNLGNGNTLAQQGSYTKTNGTTAKMGDLLLAADNLHSRFLE",
          "organism": "Neisseria meningitidis",
          "uniprot_code": "Q9JYV5",
          "uniprot_range_first": 415,
          "uniprot_range_last": 591,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MNEGEVVLTPEQIQTLRGYASRGDTYGGWRYLANLGDRYADDAAAIVGKDANLNGLNLWM\nKKGVENLWDDTVGKKTRLEKFDRVALQHFRQYARLINQNNGRLPNTSEIERSYYKAVTDN\nGVSSSAAIDLVINRSLPDMADGYWALGLGIEAERIHNEQAVNNPNGSERDNRKQLISALD\nKGFDGSFKEKHFTFLQSVMMDVTKLGVEYTIDGWQKIGGWGNGIINDLYKSVVKREWTGI\nFEIVNNNIKQGNEAFKNEINSLVHDMKAAGKEFGDDLNTQWNNLTQAAEIIYNDIVDNTS\nQGIEKGVKAIKELSEKMKNAASDLADGSAEKAKQVVEDLAQAAKEAYENAKSTAEKAAQA\nAREFFKGLPSFKDLAEKFRDLFPNPEGWIDDGHQCLAPWVKETKKRNGKYHVYDPLALDL\nDGDGIETVATKGFAGSLFDHTNNGIRTATGWVSADDGLLVRDLNGNGIIDNGAELFGDNT\nKLADGSFAKHGYAALAELDSNGDNIINAADAAFQTLRVWQDLNQDGISQANELRTLEELG\nIQSLDLAYKDVNKNLGNGNTLAQQGSYTKTDGTTAKMGDLLLAADNLHSRFKDKVELTAE\nQAKAANLAGIGRLRDLREAAALSGDLANMLKAYSAAETKEAQLALLDNLIHKWAETDSNW\nGKKSPMRLSTDWTQTANEGIALTPSQVAQLKKNALVSLSDKAKAAIDAARDRIAVLDAYT\nGQDSNTLYYMSEEDALNIVKVTNDTYDHLAKNIYQNLLFQTRLQPYLNQISFKMENDTFT\nLDFSGLVQAFNHVKETNPQKAFVDLAEMLAYGELRSWYEGRRLMTDYVEEAKKAGKFEDY\nQKVLGQETVALLAKTSGTQADDILQNVGFGHNKNVSLYGNDGNDTLIGGAGNDYLEGGSG\nSDTYVFGEGFGQDTVYNYDYATGRKDIIRFTDGITADMLTFTREGNHLLIKAKDGSGQVT\nVQSYFQNDGSGAYRIDEIHFDNGKVLDVATVKELVQQSTDGSDRLYAYQSGNTLNGGLGD\nDYLYGADGDDLLNGDAGNDSIYSGNGNDTLDGGEGNDALYGYNGNDALNGGEGNDHLNGE\nDGNDTLIGGAGNDYLEGGSGSDTYVFGKGFGQDTVYNYDYATGRKDIIRFTDGITADMLT\nFTREGNHLLIKAKDGSGQVTVQYYFQNDGSGAYRIDEIHFDNGKVLDVATVKELVQQSTD\nGSDRLYAYQSGNTLNGGLGDDYLYGADGDDLLNGDAGNDSIYSGNGNDTLDGGEGNDALY\nGYNGNDALNGGEGNDHLNGEDGNDTLIGGAGNDYLEGGSGSDTYVFGKGFGQDAVYNYDY\nATGRKDIIRFTDGITADMLTFTREGNHLLIKAKDGSGQVTVQSYFQNDGSGAYRIDEIHF\nDNGKVLDVATVKELVQQSTDGSDRLYAYQSGNTLNGGLGDDYLYGADGDDLLNGDAGNDS\nIYSGNGNDTLNGGEGNDALYGYNGNDALNGGEGNDHLNGEDGNDTLIGGAGNDYLEGGSG\nSDTYVFGKGFGQDAVYNYDYATGRKDIIRFTDGITADMLTFTREGNHLLIKAKDGSGQVT\nVQSYFQNDGSGAYRIDEIHFDNGKVLDVATVKELVQQSTDGSDRLYAYQSGSTLNGGLGD\nDYLYGADGDDLLNGDAGNDSIYSGNGNDTLDGGEGNDALYGYNGNDALNGGEGNDHLNGE\nDGNDTLIGGAGNDYLEGGSGSDTYVFGEGFGQDTVYNYHVDKNSDTMHFKGFKAADVHFI\nRSGSDLVLSASEQDNVRISGFFYGENHRVDTFVFDDAAISNPDFAKYINAGNNLVQSMSV\nFGSNTAATGGNVDANIQSVQQPLLVTPSA",
          "mw": 18.698,
          "total_mw": 18.698,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "5 mM Tris 50 mM NaCl 10 mM CaCl2 0.1% NaN3",
        "concentration_unit": "mM",
        "comment": null,
        "additive": "50 mM NaCl, 10 mM CaCl2, 0.1% NaN3",
        "concentration": 5.0,
        "pka": null,
        "ph": 7.4,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Self-processing module of iron-regulated protein FrpC (415-591)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "MUNI",
            "address": "Brno, Czech Republic",
            "full_name": "Masaryk University;   \tResearch group Structure and Dynamics of Proteins.",
            "webpage": "https://www.muni.cz/"
          }
        ],
        "contributor_name": "Vojtěch",
        "contributor_surname": "Kubáň",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": "mg/ml",
    "date": "2013-10-03",
    "storage_temperature": 30.0,
    "cell_temperature": 30.0,
    "exposure_time": 600.0,
    "number_of_frames": 4,
    "wavelength": 0.1542,
    "sample_detector_distance": null,
    "concentration_min": 1.25,
    "concentration_max": 5.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.08,
    "s_max": 4.99,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB85_fit1_model1_img.png",
          "software": "Other",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDB85_fit1_model1.pdb",
          "model_mw": 382.8,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 146
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDB85_fit1_fixed_fit_img.png",
      "software": null,
      "chi_square_value": 1.9419,
      "p_value": 0.00062,
      "fit_residual_plot": "SASDB85_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDB85_fit1.fit",
      "fit_log": null,
      "software_version": null,
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "In-house small-angle X-ray scattering data from solutions of iron-regulated protein FrpC (amino acids 415-591) in 5 mM Tris 50 mM NaCl, 10 mM CaCl2, 0.1% NaN3, pH 7.4 were collected using a Rigaku BioSAXS-1000 SAXS instrument (I(s) vs s; s = 4π sin θ/λ, where 2θ is the scattering angle and λ=0.154 nm). Different solute concentrations in the range 1.25-5.00 mg/ml were measured. Four successive 600 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration. The low angle data collected were obtained from a single concentration scattering curve.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 18.4,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.1355,
  "pddf_i0_error": 0.0005,
  "guinier_i0": 0.14,
  "guinier_i0_error": 0.0007,
  "pddf_rg": 1.643,
  "pddf_rg_error": 0.005,
  "guinier_rg": 1.7,
  "guinier_rg_error": 0.05,
  "pddf_dmax": 4.51,
  "pddf_dmax_error": null,
  "porod_volume": 20.5,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 16,
  "guinier_point_last": 47,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDB85_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2021-09-13T16:54:31.604815+02:00",
  "bragg_peak": []
}

{
  "code": "SASDB85",
  "status": "success",
  "started_at": "2026-08-11T14:41:36.019010+00:00",
  "finished_at": "2026-08-11T14:41:46.422547+00:00",
  "source_last_modified": "2021-09-13T16:54:31.604815+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDB85/",
      "path": "/data/saxsdb/sasbdb/entries/85/sasdb85/source/summary.json",
      "size": 8775,
      "sha256": "05486c711d5da17270d2ffff76fe2c7c74caa39a28e6f43b987361367aa38471"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDB85.dat",
      "path": "/data/saxsdb/sasbdb/entries/85/sasdb85/source/SASDB85.dat",
      "size": 15538,
      "sha256": "c416d289dbac71d6aec7322de7891da9323dc80ead3156de85e1d55773a49906",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDB85.out",
      "path": "/data/saxsdb/sasbdb/entries/85/sasdb85/source/SASDB85.out",
      "size": 32204,
      "sha256": "5096d7028b54ad8a83687289906971b1f15b022c6d78e757622130383de7e291",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDB85.sascif",
      "path": "/data/saxsdb/sasbdb/entries/85/sasdb85/source/SASDB85.sascif",
      "size": 5303444,
      "sha256": "6427563119e6a7a247345c2509c38b7d4135c7ee54d5162514f72ce75d15c7b1",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDB85.zip",
      "path": "/data/saxsdb/sasbdb/entries/85/sasdb85/source/SASDB85.zip",
      "size": 924785,
      "sha256": "2681b808386a0219f1406fe1054253f9d8969b58505d8a426d3cf74ad1da8092",
      "role": "full_entry_zip",
      "zip_member_count": 6,
      "zip_validation": "central_directory_readable"
    }
  ]
}