Suppressor of Copper Sensitivity C protein (ScsC) from Proteus mirabilis

{
  "code": "SASDB94",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "A shape-shifting redox foldase contributes to Proteus mirabilis copper resistance.",
    "publication": {
      "title": "A shape-shifting redox foldase contributes to Proteus mirabilis copper resistance.",
      "author_list": "Furlong EJ, Lo AW, Kurth F, Premkumar L, Totsika M, Achard MES, Halili MA, Heras B, Whitten AE, Choudhury HG, Schembri MA, Martin JL",
      "journal": "Nat Commun",
      "doi": "10.1038/ncomms16065",
      "pmid": "28722010",
      "published_date": "2017 Jul 19"
    },
    "status": "released",
    "submitted_date": "2016-10-04",
    "released_date": "2017-06-16"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDB94.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDB94.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB94_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB94_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDB94_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB94_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDB94.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "Australian  Synchrotron",
      "city": "Melbourne",
      "country": "Australia",
      "beamline_name": "SAXS/WAXS",
      "beam_geometry": "Point",
      "type_of_source": "X-ray synchrotron",
      "point_source": true,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "C-terminal catalytic domain of Suppressor of Copper Sensitivity C protein",
          "short_name": "PmScsCΔN",
          "sequence": "SNAQFRQALASEHDALYNDAASPRIGAKDAKLVLVSFTDYNCPYCKRFDPLLEKITEQYPDVAVIIKPLPFKGESSAKASQAVLSVWKEDPKAFLALHQRLMQKKTMLDNASIEDAMKSTNTSKIKLTDDSLKTLQNNLELSRKLGIQGTPATVIGDTILPGAVDYDQLEIIVKEQLAKVKK",
          "organism": "Proteus mirabilis",
          "uniprot_code": "A0A1Z1SYD5",
          "uniprot_range_first": 64,
          "uniprot_range_last": 243,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MKKTLSVLVISSLLFGANVQAAALNAAQEKEVRALVRDTLVSNPEILEEAIMALQTKKAD\nEQQAQFRQALASEHDALYNDAASPRIGAKDAKLVLVSFTDYNCPYCKRFDPLLEKITEQY\nPDVAVIIKPLPFKGESSAKASQAVLSVWKEDPKAFLALHQRLMQKKTMLDNASIEDAMKS\nTNTSKIKLTDDSLKTLQNNLELSRKLGIQGTPATVIGDTILPGAVDYDQLEIIVKEQLAK\nVKK",
          "mw": 20.15,
          "total_mw": 20.15,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "25 mM HEPES 150mM NaCl 1mM DTT",
        "concentration_unit": "mM",
        "comment": null,
        "additive": "150mM NaCl, 1mM DTT",
        "concentration": 25.0,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Suppressor of Copper Sensitivity C protein (ScsC) from Proteus mirabilis",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "ANSTO",
            "address": "Kirrawee DC, NSW 2232, Australia",
            "full_name": "Australian Nuclear Science and Technology Organisation",
            "webpage": ""
          }
        ],
        "contributor_name": "Andrew",
        "contributor_surname": "Whitten",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2012-02-29",
    "storage_temperature": 10.0,
    "cell_temperature": 10.0,
    "exposure_time": 2.0,
    "number_of_frames": 14,
    "wavelength": null,
    "sample_detector_distance": 1.6,
    "concentration_min": 2.15,
    "concentration_max": 8.85,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.086,
    "s_max": 2.487,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit1_model1_img.png",
          "software": "CORAL",
          "pdb_link": [
            {
              "pdb_code": "4xvw",
              "ext_code": "4XVW",
              "ext_type": "pdb",
              "difference_with_model": "derived"
            }
          ],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit1_model1.pdb",
          "model_mw": 73.15,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "P3",
          "comment": "",
          "user": 111
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDB94_fit1_fixed_fit_img.png",
      "software": "CORAL",
      "chi_square_value": 0.86,
      "p_value": 0.0,
      "fit_residual_plot": "SASDB94_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDB94_fit1.fit",
      "fit_log": null,
      "software_version": "",
      "description": null
    },
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit2_model1_img.png",
          "software": "EOM/RANCH",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "mix",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit2_model1.pdb",
          "model_mw": 73.7,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 111
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit2_model2_img.png",
          "software": "EOM/RANCH",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "mix",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit2_model2.pdb",
          "model_mw": 73.7,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 111
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit2_model3_img.png",
          "software": "EOM/RANCH",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "mix",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit2_model3.pdb",
          "model_mw": 73.7,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 111
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit2_model4_img.png",
          "software": "EOM/RANCH",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "mix",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit2_model4.pdb",
          "model_mw": 73.7,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 111
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit2_model5_img.png",
          "software": "EOM/RANCH",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "mix",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit2_model5.pdb",
          "model_mw": 73.7,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 111
        },
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit2_model6_img.png",
          "software": "EOM/RANCH",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "mix",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit2_model6.pdb",
          "model_mw": 73.7,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 111
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDB94_fit2_fixed_fit_img.png",
      "software": "EOM/GAJOE",
      "chi_square_value": 0.251,
      "p_value": 0.020808,
      "fit_residual_plot": "fit4columns417_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDB94_fit2.fit",
      "fit_log": null,
      "software_version": "",
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "X-ray synchrotron radiation scattering data from solutions of Suppressor of Copper Sensitivity C protein (ScsC) from Proteus mirabilis in 25 mM HEPES 150mM NaCl, 1mM DTT, pH 7.5 were collected on the SAXS/WAXS beam line of the Australian Synchrotron (Melbourne, Australia) using a 2D Photon counting Pilatus 1M-W pixel detector (s = 4π sin θ/λ, where 2θ is the scattering angle). Fourteen successive 2 second frames were collected across solute concentrations of 2.15-8.85 mg/ml. The SAXS data displayed this entry was derived from a 2.15 mg/ml sample. The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering of the solvent-blank was subtracted. The models and corresponding fits include those derived from rigid-body modelling using CORAL (top) and a representative ensemble of six trimeric ScsC structures determined using ensemble optimization method (EOM). The Rg and Dmax distributions derived from EOM are included in the full entry zip archive.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 69.9,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.1006,
  "pddf_i0_error": 0.00016,
  "guinier_i0": 0.101,
  "guinier_i0_error": null,
  "pddf_rg": 3.6,
  "pddf_rg_error": 0.01,
  "guinier_rg": 3.65,
  "guinier_rg_error": null,
  "pddf_dmax": 10.5,
  "pddf_dmax_error": null,
  "porod_volume": 92.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 3,
  "guinier_point_last": 21,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDB94_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2020-08-28T15:27:57.490687+02:00",
  "bragg_peak": []
}

{
  "code": "SASDB94",
  "status": "success",
  "started_at": "2026-08-11T14:16:30.520236+00:00",
  "finished_at": "2026-08-11T14:16:42.170445+00:00",
  "source_last_modified": "2020-08-28T15:27:57.490687+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDB94/",
      "path": "/data/saxsdb/sasbdb/entries/94/sasdb94/source/summary.json",
      "size": 11636,
      "sha256": "8167a2d1757095edb00c978d296562b4fdf53715456fbd470b56581882d16968"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDB94.dat",
      "path": "/data/saxsdb/sasbdb/entries/94/sasdb94/source/SASDB94.dat",
      "size": 8516,
      "sha256": "8e69899230f6dd6ed541a0a8d076263b0cc7aab89f76ffc7b259cce1ea1d7cba",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDB94.out",
      "path": "/data/saxsdb/sasbdb/entries/94/sasdb94/source/SASDB94.out",
      "size": 18248,
      "sha256": "238e944063660afbf8880f1f2250ec9a4b61bcb73f44f6b6f551763a7291cb66",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDB94.sascif",
      "path": "/data/saxsdb/sasbdb/entries/94/sasdb94/source/SASDB94.sascif",
      "size": 3343740,
      "sha256": "7385276167823f0414724c1d081d1f05e932b9ceb4b7b2e90b78273672225ac2",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDB94.zip",
      "path": "/data/saxsdb/sasbdb/entries/94/sasdb94/source/SASDB94.zip",
      "size": 1386591,
      "sha256": "88c9a755eadaad41d1032127c1b70d7b47f35f8c3ca7bc6eca437eed4c030e48",
      "role": "full_entry_zip",
      "zip_member_count": 14,
      "zip_validation": "central_directory_readable"
    }
  ]
}