The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
full_entry_zip：source record and ZIP contents (14 items)
{
"path": "/data/saxsdb/sasbdb/entries/94/sasdb94/source/SASDB94.zip",
"role": "full_entry_zip",
"sha256": "88c9a755eadaad41d1032127c1b70d7b47f35f8c3ca7bc6eca437eed4c030e48",
"size": 1386591,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDB94.zip",
"zip_member_count": 14,
"zip_members": [
{
"crc32": "9406cee3",
"name": "SASDB94/experimental_data/SASDB94.dat",
"size": 8516
},
{
"crc32": "e08aa80e",
"name": "SASDB94/pddf/SASDB94.out",
"size": 18248
},
{
"crc32": "d928f7d3",
"name": "SASDB94/SASDB94_fit1.fit",
"size": 9881
},
{
"crc32": "5bde19dc",
"name": "SASDB94/SASDB94_fit1_model1.pdb",
"size": 342487
},
{
"crc32": "d781627f",
"name": "SASDB94/SASDB94_fit2.fit",
"size": 8256
},
{
"crc32": "4f039758",
"name": "SASDB94/SASDB94_fit2_model1.pdb",
"size": 283101
},
{
"crc32": "42f1ecec",
"name": "SASDB94/SASDB94_fit2_model2.pdb",
"size": 283101
},
{
"crc32": "e5352a6b",
"name": "SASDB94/SASDB94_fit2_model3.pdb",
"size": 283101
},
{
"crc32": "fe86f7bf",
"name": "SASDB94/SASDB94_fit2_model4.pdb",
"size": 283101
},
{
"crc32": "8365a043",
"name": "SASDB94/SASDB94_fit2_model5.pdb",
"size": 283101
},
{
"crc32": "4e657a8d",
"name": "SASDB94/SASDB94_fit2_model6.pdb",
"size": 278046
},
{
"crc32": "40ef4288",
"name": "SASDB94/SASDB94_fit2_rg_distribution.dat",
"size": 2383
},
{
"crc32": "28dd994b",
"name": "SASDB94/additional_files/ScsC_EOM_ensemble_and_dat_file.zip",
"size": 848816
},
{
"crc32": "c20195b5",
"name": "SASDB94/additional_files/README.txt",
"size": 119
}
],
"zip_validation": "central_directory_readable"
}Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDB94",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "A shape-shifting redox foldase contributes to Proteus mirabilis copper resistance.",
"publication": {
"title": "A shape-shifting redox foldase contributes to Proteus mirabilis copper resistance.",
"author_list": "Furlong EJ, Lo AW, Kurth F, Premkumar L, Totsika M, Achard MES, Halili MA, Heras B, Whitten AE, Choudhury HG, Schembri MA, Martin JL",
"journal": "Nat Commun",
"doi": "10.1038/ncomms16065",
"pmid": "28722010",
"published_date": "2017 Jul 19"
},
"status": "released",
"submitted_date": "2016-10-04",
"released_date": "2017-06-16"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDB94.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDB94.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB94_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB94_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDB94_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDB94_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDB94.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "Australian Synchrotron",
"city": "Melbourne",
"country": "Australia",
"beamline_name": "SAXS/WAXS",
"beam_geometry": "Point",
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "C-terminal catalytic domain of Suppressor of Copper Sensitivity C protein",
"short_name": "PmScsCΔN",
"sequence": "SNAQFRQALASEHDALYNDAASPRIGAKDAKLVLVSFTDYNCPYCKRFDPLLEKITEQYPDVAVIIKPLPFKGESSAKASQAVLSVWKEDPKAFLALHQRLMQKKTMLDNASIEDAMKSTNTSKIKLTDDSLKTLQNNLELSRKLGIQGTPATVIGDTILPGAVDYDQLEIIVKEQLAKVKK",
"organism": "Proteus mirabilis",
"uniprot_code": "A0A1Z1SYD5",
"uniprot_range_first": 64,
"uniprot_range_last": 243,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MKKTLSVLVISSLLFGANVQAAALNAAQEKEVRALVRDTLVSNPEILEEAIMALQTKKAD\nEQQAQFRQALASEHDALYNDAASPRIGAKDAKLVLVSFTDYNCPYCKRFDPLLEKITEQY\nPDVAVIIKPLPFKGESSAKASQAVLSVWKEDPKAFLALHQRLMQKKTMLDNASIEDAMKS\nTNTSKIKLTDDSLKTLQNNLELSRKLGIQGTPATVIGDTILPGAVDYDQLEIIVKEQLAK\nVKK",
"mw": 20.15,
"total_mw": 20.15,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "25 mM HEPES 150mM NaCl 1mM DTT",
"concentration_unit": "mM",
"comment": null,
"additive": "150mM NaCl, 1mM DTT",
"concentration": 25.0,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Suppressor of Copper Sensitivity C protein (ScsC) from Proteus mirabilis",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "ANSTO",
"address": "Kirrawee DC, NSW 2232, Australia",
"full_name": "Australian Nuclear Science and Technology Organisation",
"webpage": ""
}
],
"contributor_name": "Andrew",
"contributor_surname": "Whitten",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2012-02-29",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 2.0,
"number_of_frames": 14,
"wavelength": null,
"sample_detector_distance": 1.6,
"concentration_min": 2.15,
"concentration_max": 8.85,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.086,
"s_max": 2.487,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit1_model1_img.png",
"software": "CORAL",
"pdb_link": [
{
"pdb_code": "4xvw",
"ext_code": "4XVW",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit1_model1.pdb",
"model_mw": 73.15,
"bead_radius": 1.9,
"log": null,
"symmetry": "P3",
"comment": "",
"user": 111
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDB94_fit1_fixed_fit_img.png",
"software": "CORAL",
"chi_square_value": 0.86,
"p_value": 0.0,
"fit_residual_plot": "SASDB94_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDB94_fit1.fit",
"fit_log": null,
"software_version": "",
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit2_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit2_model1.pdb",
"model_mw": 73.7,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 111
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit2_model2_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit2_model2.pdb",
"model_mw": 73.7,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 111
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit2_model3_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit2_model3.pdb",
"model_mw": 73.7,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 111
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit2_model4_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit2_model4.pdb",
"model_mw": 73.7,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 111
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit2_model5_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit2_model5.pdb",
"model_mw": 73.7,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 111
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDB94_fit2_model6_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDB94_fit2_model6.pdb",
"model_mw": 73.7,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 111
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDB94_fit2_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 0.251,
"p_value": 0.020808,
"fit_residual_plot": "fit4columns417_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDB94_fit2.fit",
"fit_log": null,
"software_version": "",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "X-ray synchrotron radiation scattering data from solutions of Suppressor of Copper Sensitivity C protein (ScsC) from Proteus mirabilis in 25 mM HEPES 150mM NaCl, 1mM DTT, pH 7.5 were collected on the SAXS/WAXS beam line of the Australian Synchrotron (Melbourne, Australia) using a 2D Photon counting Pilatus 1M-W pixel detector (s = 4π sin θ/λ, where 2θ is the scattering angle). Fourteen successive 2 second frames were collected across solute concentrations of 2.15-8.85 mg/ml. The SAXS data displayed this entry was derived from a 2.15 mg/ml sample. The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering of the solvent-blank was subtracted. The models and corresponding fits include those derived from rigid-body modelling using CORAL (top) and a representative ensemble of six trimeric ScsC structures determined using ensemble optimization method (EOM). The Rg and Dmax distributions derived from EOM are included in the full entry zip archive.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 69.9,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.1006,
"pddf_i0_error": 0.00016,
"guinier_i0": 0.101,
"guinier_i0_error": null,
"pddf_rg": 3.6,
"pddf_rg_error": 0.01,
"guinier_rg": 3.65,
"guinier_rg_error": null,
"pddf_dmax": 10.5,
"pddf_dmax_error": null,
"porod_volume": 92.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 3,
"guinier_point_last": 21,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDB94_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-08-28T15:27:57.490687+02:00",
"bragg_peak": []
}
