The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDBJ2",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Wing phosphorylation is a major functional determinant of the Lrs14-type biofilm and motility regulator AbfR1 in Sulfolobus acidocaldarius.",
"publication": {
"title": "Wing phosphorylation is a major functional determinant of the Lrs14-type biofilm and motility regulator AbfR1 in Sulfolobus acidocaldarius.",
"author_list": "Li L, Banerjee A, Bischof LF, Maklad HR, Hoffmann L, Henche AL, Veliz F, Bildl W, Schulte U, Orell A, Essen LO, Peeters E, Albers SV",
"journal": "Mol Microbiol",
"doi": "10.1111/mmi.13735",
"pmid": "28628237",
"published_date": "2017 Sep"
},
"status": "released",
"submitted_date": "2015-10-01",
"released_date": "2017-05-23"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBJ2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBJ2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBJ2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBJ2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBJ2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBJ2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBJ2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "40bp long dsDNA-Sa Oligonucleotide",
"short_name": "dsDNA-Sa Oligo",
"sequence": "GTAGTAAGATTTAAAAAAACATACTAAGATATAAATTAAC\r\n",
"organism": null,
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "DNA",
"uniprot_sequence": null,
"mw": 24.7,
"total_mw": 24.7,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Wild-type archaeal biofilm regulator 1 (ABfR1: Transcriptional regulator ArsR family).",
"short_name": "ABfR1-WT",
"sequence": "MSIEITEKYVILKRFLSVAYGLSESEIDTFLRILESKEGKDIDAISAELKISKSRTSIIL KKLSDAGLVDKEKGDNMKGGRPKYVYSVNKEELKNRLIAKSEELCKELNQVIKSFI\r\n\r\n",
"organism": "Sulfolobus acidocaldarius",
"uniprot_code": "Q4JBH1",
"uniprot_range_first": 1,
"uniprot_range_last": 116,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MSIEITEKYVILKRFLSVAYGLSESEIDTFLRILESKEGKDIDAISAELKISKSRTSIIL\nKKLSDAGLVDKEKGDNMKGGRPKYVYSVNKEELKNRLIAKSEELCKELNQVIKSFI",
"mw": 13.16,
"total_mw": 26.32,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "0.5 x Tris/Borate/EDTA (TBE)",
"concentration_unit": "v/v",
"comment": null,
"additive": null,
"concentration": 0.5,
"pka": null,
"ph": null,
"deuteration": null
},
"purity_method": null,
"name": "Wild-type archaeal biofilm regulator 1 (ABfR1) bound to 40bp dsDNA-Sa oligonucleotide.",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Marburg, Germany",
"full_name": "Philipps-Universität Marburg",
"webpage": ""
}
],
"contributor_name": "Ankan",
"contributor_surname": "Banerjee",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": "mg/ml",
"date": "2015-08-27",
"storage_temperature": 4.0,
"cell_temperature": 4.0,
"exposure_time": 20.0,
"number_of_frames": 10,
"wavelength": 0.93,
"sample_detector_distance": 2.43,
"concentration_min": null,
"concentration_max": 3.5,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.033,
"s_max": 4.934,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBJ2_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBJ2_fit1_model1.pdb",
"model_mw": null,
"bead_radius": 4.2,
"log": null,
"symmetry": "",
"comment": "",
"user": 72
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBJ2_fit1_fit_img.png",
"software": null,
"chi_square_value": 1.55,
"p_value": 2e-06,
"fit_residual_plot": "SASDBJ2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBJ2_fit1.fir",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "X-ray synchrotron radiation scattering data from solutions of N terminal affinity tag cleaved (by thrombin) wild type AbfR1 in complex with SaOligo in 0.5 x TBE buffer was collected on the BM29 beam line on the storage ring ESRF (Grenoble, France) using a 2D Photon counting Pilatus 1M pixel detector (s = 4π sin θ/λ, where 2θ is the scattering angle). A single concentration of 3.5mg/ mL was measured in 10 successive 20 second frames. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted .The analysis was performed using the ATSAS package. The displayed model is the best fit model with the lowest reduced Chi-squared value (1.55) after imposing P2 symmetry. The DNA is considerably bent in complex with ABfR1.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 51.3,
"experimental_mw_error": null,
"guinier_i0_mw": 47.93,
"guinier_i0_mw_error": null,
"porod_mw": 41.0,
"porod_mw_error": null,
"pddf_i0": 51.3,
"pddf_i0_error": null,
"guinier_i0": 47.93,
"guinier_i0_error": null,
"pddf_rg": 3.35,
"pddf_rg_error": null,
"guinier_rg": 3.0,
"guinier_rg_error": null,
"pddf_dmax": 11.76,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 52,
"guinier_point_last": 83,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDBJ2_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDBJ2",
"status": "success",
"started_at": "2026-08-11T13:39:18.782209+00:00",
"finished_at": "2026-08-11T13:39:27.134122+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBJ2/",
"path": "/data/saxsdb/sasbdb/entries/j2/sasdbj2/source/summary.json",
"size": 8120,
"sha256": "69ddf94d8d442af9f67631923467e36dbdb2ded1a2d29aa706c822cf53d8baee"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDBJ2.dat",
"path": "/data/saxsdb/sasbdb/entries/j2/sasdbj2/source/SASDBJ2.dat",
"size": 57983,
"sha256": "cf697238ad975bd4b7048ee55702131f3422b519572b077bd4ef729e7a53df8b",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDBJ2.out",
"path": "/data/saxsdb/sasbdb/entries/j2/sasdbj2/source/SASDBJ2.out",
"size": 49216,
"sha256": "fc09c2dd1843315017b72c640683e760af66527dc5b02365c6cd5359c804536d",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBJ2.sascif",
"path": "/data/saxsdb/sasbdb/entries/j2/sasdbj2/source/SASDBJ2.sascif",
"size": 138120,
"sha256": "12eca398368b8844fe2088568c3bd7deface17bc419bbad8ef7624ef83598627",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDBJ2.zip",
"path": "/data/saxsdb/sasbdb/entries/j2/sasdbj2/source/SASDBJ2.zip",
"size": 40617,
"sha256": "9bbb121c02ee6bc159687fd0586ea959e99879e6fee5345863709399c039a14c",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
