Geobacillus stearothermophilus DnaB full-length

{
  "code": "SASDBK9",
  "status": "Published",
  "type_of_curve": "Merged",
  "angular_unit": "1/A",
  "project": {
    "title": "Structural analyses of the bacterial primosomal protein DnaB reveal that it is a tetramer and forms a complex with a primosomal re-initiation protein.",
    "publication": {
      "title": "Structural analyses of the bacterial primosomal protein DnaB reveal that it is a tetramer and forms a complex with a primosomal re-initiation protein.",
      "author_list": "Li YC, Naveen V, Lin MG, Hsiao CD",
      "journal": "J Biol Chem",
      "doi": "10.1074/jbc.M117.792002",
      "pmid": "28808061",
      "published_date": "2017 Sep 22"
    },
    "status": "released",
    "submitted_date": "2017-01-04",
    "released_date": "2018-01-23"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBK9.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBK9.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBK9_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBK9_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBK9_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBK9_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBK9.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Flat Panel sensor C10158DK-3957(X)",
        "resolution": 50.0
      },
      "name": "Taiwan Photon Source, NSRRC",
      "city": "Hsinchu",
      "country": "Taiwan",
      "beamline_name": "23A",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Geobacillus stearothermophilus DnaB full-length",
          "short_name": "GstDnaBFL",
          "sequence": "MQHHWKELIAVDRYTVQSRGVLQEVDRKVLTLLYQPLIGCRALALYMTLWGELELLDGQEATHHRLMALM\r\nQCGLPDIYSERLKLEGIGLLDTYVHAKEADEPKLFLYELRPPLAPDQFFRDEMLSVFLRRQVGRHLFIQL\r\nSNFFARPSIDETKFTQVTRSFSDVFSAVPAEQIVAGLSEEAGPELLEGKDHIRRDEASYVLDDGVFDFEL\r\nFFAGLSKQLVPRRAVTAKVKEAIKKLAFLYGIPPLEMQKLVLGVIDPAYHIDIDALRRAAREWYELEHGG\r\nVEPRLVERVQPLAYRTMENIEPRTKEEQLMKQLETISPRQLLKEISGGAEPSLADLQLIEDVMFKQQLLP\r\nGVVNVLIYYVMLRTNMKLSKKYVEKIASHWARKKVKTVKEAMELAKEEAKTYQNWANEKEKGTRTVRKVV\r\nRTEIVPDWLNMDYSQPDDDDFDVEQARKELEERLKKYRDES",
          "organism": "Geobacillus stearothermophilus",
          "uniprot_code": "A0A0K2H6I1",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "tetramer",
          "molecular_type": "protein",
          "uniprot_sequence": "MQHHWKELIAVDRYTVQSRGVLQEVDRKVLTLLYQPLIGCRALALYMTLWGELELLDGQE\nATHHRLMALMQCGLPDIYSERLKLEGIGLLDTYVHAKEADEPKLFLYELRPPLAPDQFFR\nDEMLSVFLRRQVGRHLFIQLSNFFARPSIDETKFTQVTRSFSDVFSAVPAEQIVAGLSEE\nAGPELLEGKDHIRRDEASYVLDDGVFDFELFFAGLSKQLVPRRAVTAKVKEAIKKLAFLY\nGIPPLEMQKLVLGVIDPAYHIDIDALRRAAREWYELEHGGVEPRLVERVQPLAYRTMENI\nEPRTKEEQLMKQLETISPRQLLKEISGGAEPSLADLQLIEDIMFQQQLLPGVVNVLIYYV\nMLRTNMKLSKKYVEKIASHWARKKVKTVKEAMELAKEEAKTYQNWANEKEKGTRTVRKVV\nRTEIVPDWLNMDYSQPDDDDFDVEQARKELEERLKKYRDES",
          "mw": 53.494,
          "total_mw": 213.976,
          "number_molecules": 4,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM Tris, 300 mM NaCl and 5 mM β-ME",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Geobacillus stearothermophilus DnaB full-length",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Taipei, Taiwan",
            "full_name": "Academia Sinica",
            "webpage": "https://www.sinica.edu.tw"
          }
        ],
        "contributor_name": "YiChing",
        "contributor_surname": "Li",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2015-03-12",
    "storage_temperature": null,
    "cell_temperature": 15.0,
    "exposure_time": 30.0,
    "number_of_frames": 10,
    "wavelength": 0.08285,
    "sample_detector_distance": null,
    "concentration_min": 2.0,
    "concentration_max": 10.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.112,
    "s_max": 3.317,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBK9_fit1_model1_img.png",
          "software": "GASBOR",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": "",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDBK9_fit1_model1.pdb",
          "model_mw": null,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": "",
          "comment": "",
          "user": 194
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBK9_fit1_fit_img.png",
      "software": "GASBOR",
      "chi_square_value": 1.43,
      "p_value": 0.000199,
      "fit_residual_plot": "SASDBK9_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBK9_fit1.fir",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/hQ2_4.log",
      "software_version": "",
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "ATSAS 2.6.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of Geobacillus stearothermophilus DnaB full-length in 20 mM Tris, 300 mM NaCl and 5 mM β-ME, pH 8 were collected on the 23A beam line at the Taiwan Photon Source storage ring (NSRRC, Hsinchu, Taiwan) using a Flat Panel sensor C10158DK-3957(X) detector at a wavelength of λ = 0.08285 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). Solute concentrations ranging between 2 and 10 mg/ml were measured at 15°C. 10 successive 30 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 53.526,
  "experimental_mw_error": null,
  "guinier_i0_mw": 199.135,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.191,
  "pddf_i0_error": null,
  "guinier_i0": 0.191,
  "guinier_i0_error": null,
  "pddf_rg": 5.745,
  "pddf_rg_error": 0.199,
  "guinier_rg": 5.745,
  "guinier_rg_error": null,
  "pddf_dmax": 20.0,
  "pddf_dmax_error": null,
  "porod_volume": 431.66,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": null,
  "guinier_point_last": null,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDBK9_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2021-12-03T19:22:21.480997+01:00",
  "bragg_peak": []
}

{
  "code": "SASDBK9",
  "status": "success",
  "started_at": "2026-08-11T16:16:08.811604+00:00",
  "finished_at": "2026-08-11T16:16:19.657850+00:00",
  "source_last_modified": "2021-12-03T19:22:21.480997+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBK9/",
      "path": "/data/saxsdb/sasbdb/entries/k9/sasdbk9/source/summary.json",
      "size": 8242,
      "sha256": "0bb0e2069cd49af649c761abbd4d9ecac9c314ec4e17f3115d5a0d185801e8df"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDBK9.dat",
      "path": "/data/saxsdb/sasbdb/entries/k9/sasdbk9/source/SASDBK9.dat",
      "size": 10745,
      "sha256": "256fce660663944289cd22b62d1ed9c8e227c47b29e743879424065989e5392c",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDBK9.out",
      "path": "/data/saxsdb/sasbdb/entries/k9/sasdbk9/source/SASDBK9.out",
      "size": 24025,
      "sha256": "7a5cc2096ee7dfb6c649296cc91ae0690d94b3720ddf8914e63ee0d6b16851ef",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBK9.sascif",
      "path": "/data/saxsdb/sasbdb/entries/k9/sasdbk9/source/SASDBK9.sascif",
      "size": 388823,
      "sha256": "7fb3a83bb15ddd8844bcddc974bd577b56f46c2b6ac6eeecf8a1dd185e9dec6e",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDBK9.zip",
      "path": "/data/saxsdb/sasbdb/entries/k9/sasdbk9/source/SASDBK9.zip",
      "size": 73449,
      "sha256": "f3d9389d1bc0d55aae62bfb0ad0eef0e09846da0cd16a90626535f25a420863b",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}