Truncated construct of human p23 (1-117)

{
  "code": "SASDBL6",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "The C-terminal region of the human p23 chaperone modulates its structure and function.",
    "publication": {
      "title": "The C-terminal region of the human p23 chaperone modulates its structure and function.",
      "author_list": "Seraphim TV, Gava LM, Mokry DZ, Cagliari TC, Barbosa LR, Ramos CH, Borges JC",
      "journal": "Arch Biochem Biophys",
      "doi": "10.1016/j.abb.2014.10.015",
      "pmid": "25447839",
      "published_date": "2015 Jan 1"
    },
    "status": "released",
    "submitted_date": "2016-09-13",
    "released_date": "2016-10-05"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBL6.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBL6.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBL6_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBL6_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBL6_juKBgVY_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBL6_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBL6.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "20Hz",
        "name": "Pilatus 300K",
        "resolution": null
      },
      "name": "Brazilian Synchrotron Light Laboratory",
      "city": "Campinas",
      "country": "Brazil",
      "beamline_name": "SAXS1 Beamline",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Prostaglandin E synthase 3 (1-117)",
          "short_name": "PTGES, Sba1, p23",
          "sequence": "GSMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRK\r\nGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDM",
          "organism": "Homo sapiens",
          "uniprot_code": "Q15185",
          "uniprot_range_first": 1,
          "uniprot_range_last": 117,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID\nPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF\nDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE",
          "mw": 14.031,
          "total_mw": 14.031,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "25 mM Tris-HCl, 100 mM NaCl, 5 mM B-mercaptoethanol",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Truncated construct of human p23 (1-117)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "São Carlos - SP - Brasil",
            "full_name": "Instituto de Química de São Carlos",
            "webpage": ""
          }
        ],
        "contributor_name": "Júlio",
        "contributor_surname": "Borges",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2013-06-21",
    "storage_temperature": 4.0,
    "cell_temperature": 20.0,
    "exposure_time": 30.0,
    "number_of_frames": 2,
    "wavelength": 0.1488,
    "sample_detector_distance": 1.0,
    "concentration_min": 1.0,
    "concentration_max": 2.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.206,
    "s_max": 3.684,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "GNOM v4.5a",
  "i0_calibration_standard": null,
  "description": "Samples were measured at 1 mg/mL and 2 mg/mL in 1 mm path-length mica cells.\r\nAll curves were inspected for X-ray damage and aggregation.\r\nThe experimental molecular weight was determined by analytical ultracentrifugation.",
  "experiment_description": "Synchrotron SAXS data from solutions of truncated human p23 (1-117) in 25 mM Tris-HCl, 100 mM NaCl, 5 mM β-mercaptoethanol, pH 7.5, were collected on the SAXS1 Beamline at the Brazilian Synchrotron Light Laboratory (Campinas, Brazil) using a 20Hz Pilatus 300K detector at a sample-detector distance of 1 m and at a wavelength of λ = 0.1488 nm (I(s) vs s, where s = 4π sin θ/λ and 2θ is the scattering angle). Solute concentrations ranging between 1 and 2 mg/ml were measured at 20°C. Two successive 30 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the radially averaged scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 15.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.01254,
  "pddf_i0_error": 2e-05,
  "guinier_i0": 0.01265,
  "guinier_i0_error": 3e-05,
  "pddf_rg": 1.959,
  "pddf_rg_error": 0.006,
  "guinier_rg": 1.91,
  "guinier_rg_error": 0.08,
  "pddf_dmax": 7.0,
  "pddf_dmax_error": null,
  "porod_volume": 28.5,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 39,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDBL6_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDBL6",
  "status": "success",
  "started_at": "2026-08-11T16:37:10.679233+00:00",
  "finished_at": "2026-08-11T16:37:18.090221+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBL6/",
      "path": "/data/saxsdb/sasbdb/entries/l6/sasdbl6/source/summary.json",
      "size": 6462,
      "sha256": "b54dc308a665efd9126dea1ec70b19bbd0706cd01351c0a384a644426396a1a9"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDBL6.dat",
      "path": "/data/saxsdb/sasbdb/entries/l6/sasdbl6/source/SASDBL6.dat",
      "size": 8861,
      "sha256": "3f22a3d39b5efdcdb982470630ae6a00f47ebf1e7dcc8a00dd4b15fac0fade2b",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDBL6.out",
      "path": "/data/saxsdb/sasbdb/entries/l6/sasdbl6/source/SASDBL6.out",
      "size": 27566,
      "sha256": "606ce0afba6be97a0c438ce6f1df20da8a59ea105d4f892ebadbbc1f275c8694",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBL6.sascif",
      "path": "/data/saxsdb/sasbdb/entries/l6/sasdbl6/source/SASDBL6.sascif",
      "size": 39606,
      "sha256": "43410c2f81756f787bd8bc87d24a9af8d15b3ecf5330d69b873417890cac9b63",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDBL6.zip",
      "path": "/data/saxsdb/sasbdb/entries/l6/sasdbl6/source/SASDBL6.zip",
      "size": 10985,
      "sha256": "9ed367356c37d1aabbd0339990a12e35bebce197c58f6fbd06fa8588881cb543",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}