YezG: a cognate immunity protein of YeeF from Bacillus subtilis

{
  "code": "SASDBM9",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "YeeF, a polymorphic toxin from Bacillus subtilis, is a ribosomal RNase with promiscuous DNA binding property",
    "publication": null,
    "status": "released",
    "submitted_date": "2017-01-05",
    "released_date": "2021-09-20"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBM9.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBM9.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBM9_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBM9_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBM9_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBM9_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBM9.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "1D diode array detector",
        "name": "Mythen 1K",
        "resolution": 50.0
      },
      "name": "CSIR - Institute of Microbial Technology (IMTech)",
      "city": "Chandigarh",
      "country": "India",
      "beamline_name": "Anton Paar SAXSpace",
      "beam_geometry": null,
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "YezG, cognate  immunity protein of YeeF",
          "short_name": "YezG",
          "sequence": "MDTPKMGDLYQRIANQINEMIPSEWENVYLYAEILDDSSEVYFYFNIPGKNEFLYSHNIPEHFNVSEDIY\r\nDDLLIELQESFEELREEYEKNNPETWTNLTLKLDRTGQFSIDYNYEDVIASELNGSQRKAVWVYKNLGLM\r\nPKRKTVRDFLEDYIKTNEGKI",
          "organism": "Bacillus subtilis subsp. spizizenii",
          "uniprot_code": "E0TU95",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MDTPKMGDLYQRIANQINEMIPSEWENVYLYAEILDDSSEVYFYFNIPGKNEFLYSHNIP\nEHFNVSEDIYDDLLIELQESFEELREEYEKNNPETWTNLTLKLDRTGQFSIDYNYEDVIA\nSELNGSQRKAVWVYKNLGLMPKRKTVRDFLEDYIKTNEGKI",
          "mw": 19.234,
          "total_mw": 19.234,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM HEPES 150 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "YezG: a cognate immunity protein of YeeF from Bacillus subtilis",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "CSIR",
            "address": "Chandigarh, India",
            "full_name": "CSIR-Institute of Microbial Technology",
            "webpage": "http://www.imtech.res.in/"
          }
        ],
        "contributor_name": "Krishan",
        "contributor_surname": "Gopal",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-08-17",
    "storage_temperature": 4.0,
    "cell_temperature": 25.0,
    "exposure_time": 1800.0,
    "number_of_frames": 1,
    "wavelength": 0.15418,
    "sample_detector_distance": null,
    "concentration_min": null,
    "concentration_max": 10.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.139,
    "s_max": 6.0,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBM9_fit1_model1_img.png",
          "software": "DAMMIN",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": "2.7.2",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDBM9_fit1_model1.pdb",
          "model_mw": 29.918,
          "bead_radius": 2.25,
          "log": "https://www.sasbdb.org/media/log_files/yeefip.log",
          "symmetry": "",
          "comment": "",
          "user": 196
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBM9_fit1_fixed_fit_img.png",
      "software": "DAMMIN",
      "chi_square_value": 0.53,
      "p_value": 0.0543,
      "fit_residual_plot": "SASDBM9_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBM9_fit1.fir",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/yeefip.log",
      "software_version": "2.7.2",
      "description": null
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "ATSAS 2.7.2",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS data from solutions of YezG in 20 mM HEPES 150 mM NaCl, pH 7.5 were collected on the IMTECH camera (Chandigarh, India) using a Diode 1D CMOS Mythen detector at a wavelength of λ = 0.15418 nm (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). A single solute concentration of 10 mg/ml was measured at 25°C for 1800 seconds. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted to produce the final scattering profile for this entry.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 26.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 28.4,
  "porod_mw_error": null,
  "pddf_i0": 68570.0,
  "pddf_i0_error": 674.0,
  "guinier_i0": 69307.0,
  "guinier_i0_error": 843.0,
  "pddf_rg": 2.07,
  "pddf_rg_error": 0.03,
  "guinier_rg": 2.08,
  "guinier_rg_error": null,
  "pddf_dmax": 6.1,
  "pddf_dmax_error": null,
  "porod_volume": 45.58,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 5,
  "guinier_point_last": 70,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDBM9_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2021-09-20T13:31:35.480316+02:00",
  "bragg_peak": []
}

{
  "code": "SASDBM9",
  "status": "success",
  "started_at": "2026-08-11T16:17:32.323581+00:00",
  "finished_at": "2026-08-11T16:17:41.163317+00:00",
  "source_last_modified": "2021-09-20T13:31:35.480316+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBM9/",
      "path": "/data/saxsdb/sasbdb/entries/m9/sasdbm9/source/summary.json",
      "size": 6993,
      "sha256": "73174a46af723a04d1d964e8291b6c5d8640ee96b82b8649a81d0d43dbd17e3d"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDBM9.dat",
      "path": "/data/saxsdb/sasbdb/entries/m9/sasdbm9/source/SASDBM9.dat",
      "size": 42336,
      "sha256": "fd974631440a9a5e3edbee5a400ef7707fb8a87203f76ec538df072083f72d69",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDBM9.out",
      "path": "/data/saxsdb/sasbdb/entries/m9/sasdbm9/source/SASDBM9.out",
      "size": 47582,
      "sha256": "e4610897503f6d7f863754cc9c27d1a14e65ec95fa1abf40b714433eca3b2cf2",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBM9.sascif",
      "path": "/data/saxsdb/sasbdb/entries/m9/sasdbm9/source/SASDBM9.sascif",
      "size": 290874,
      "sha256": "66d770f510e73acba56086d4aa73d342852b83f82e45e14ddc2e5a2f3b1fe27d",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDBM9.zip",
      "path": "/data/saxsdb/sasbdb/entries/m9/sasdbm9/source/SASDBM9.zip",
      "size": 54382,
      "sha256": "f8e0e2af4e63d80bde283b21a2c399a82aa51febb08e92e87ffb26b9d7ad502f",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}