The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Open the original SASBDB entry
Buffer and Sample Properties
Acquisition Conditions and Instrument
Original SASBDB Plots Experimental I(q) Experimental I(q), log-log Guinier plot Kratky plot P(r) plot Downloadable Files
curve：source record {
"path": "/data/saxsdb/sasbdb/entries/n2/sasdbn2/source/SASDBN2.dat",
"role": "curve",
"sha256": "3a7eaae925af0dff7640585bbda1abb2c4b8ea41abd5a495a0d609edb6861a8e",
"size": 9223,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDBN2.dat"
} full_entry_zip：source record and ZIP contents (8 items) {
"path": "/data/saxsdb/sasbdb/entries/n2/sasdbn2/source/SASDBN2.zip",
"role": "full_entry_zip",
"sha256": "e6c46e5cfbbdd0c4d56c3cd8e27d89d4702da2cc079077ca7c4f5f1c40b0076a",
"size": 135649,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDBN2.zip",
"zip_member_count": 8,
"zip_members": [
{
"crc32": "47dc2c44",
"name": "SASDBN2/experimental_data/SASDBN2.dat",
"size": 9223
},
{
"crc32": "e04debe2",
"name": "SASDBN2/pddf/SASDBN2.out",
"size": 22245
},
{
"crc32": "a7494ae7",
"name": "SASDBN2/SASDBN2_fit1.fit",
"size": 6038
},
{
"crc32": "29b8172a",
"name": "SASDBN2/SASDBN2_fit1_model1.pdb",
"size": 62480
},
{
"crc32": "d2c9eed2",
"name": "SASDBN2/SASDBN2_fit1_model2.pdb",
"size": 60940
},
{
"crc32": "0bb59a58",
"name": "SASDBN2/SASDBN2_fit1_rg_distribution.dat",
"size": 2374
},
{
"crc32": "018d4384",
"name": "SASDBN2/additional_files/EOM_files_SASDBN2.zip",
"size": 89049
},
{
"crc32": "e3801e8d",
"name": "SASDBN2/additional_files/README.txt",
"size": 180
}
],
"zip_validation": "central_directory_readable"
} pddf：source record {
"path": "/data/saxsdb/sasbdb/entries/n2/sasdbn2/source/SASDBN2.out",
"role": "pddf",
"sha256": "34a10a0f35dcb58aa09148e3d05280c76ed181e27e72baa61bf33cd79d1949e7",
"size": 22245,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDBN2.out"
} sascif：source record {
"path": "/data/saxsdb/sasbdb/entries/n2/sasdbn2/source/SASDBN2.sascif",
"role": "sascif",
"sha256": "fd769e6340b8c4a37aba837ca7a08c7eb695e5bb0a441cffa4becb05a9882cd4",
"size": 247677,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBN2.sascif"
} summary：source record {
"path": "/data/saxsdb/sasbdb/entries/n2/sasdbn2/source/summary.json",
"sha256": "2443af9e08549b2ff06fcc8eb05a10cbd8d92730d5bffe1989dae3a98dc1b501",
"size": 8144,
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBN2/"
} All source fields (unfiltered)
Every source field is expanded here, including empty values, list members and fields already shown above.
summary.json：176 field values manifest.json：36 field values View the complete summary.json source {
"code": "SASDBN2",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "New conformations of linear polyubiquitin chains from crystallographic and solution-scattering studies expand the conformational space of polyubiquitin.",
"publication": {
"title": "New conformations of linear polyubiquitin chains from crystallographic and solution-scattering studies expand the conformational space of polyubiquitin.",
"author_list": "Thach TT, Shin D, Han S, Lee S",
"journal": "Acta Crystallogr D Struct Biol",
"doi": "10.1107/S2059798316001510",
"pmid": "27050132",
"published_date": "2016 Apr"
},
"status": "released",
"submitted_date": "2015-10-16",
"released_date": "2016-04-07"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBN2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBN2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBN2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBN2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBN2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBN2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBN2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "CCD",
"name": "ADSC Quantum 315",
"resolution": 315.0
},
"name": "Pohang Accelerator Laboratory",
"city": "Pohang",
"country": "South Korea",
"beamline_name": "5C",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Linear di-ubiquitin",
"short_name": null,
"sequence": "MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE\r\nGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH\r\nLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENV\r\nKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY\r\nNIQKESTLHLVLRLRGG",
"organism": "Homo sapiens",
"uniprot_code": "Q5U5U6",
"uniprot_range_first": 1,
"uniprot_range_last": 152,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN\nIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI\nFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA\nKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC",
"mw": 17.111,
"total_mw": 17.111,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Tris 150 mM NaCl 1 mM MgCl2",
"concentration_unit": null,
"comment": null,
"additive": "150 mM NaCl, 1 mM MgCl2",
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Human linear diubiquitin",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Seoul, SK",
"full_name": "Sungkyunkwan University",
"webpage": "http://www.skku.edu/eng_home/index.jsp"
}
],
"contributor_name": "Donghyuk",
"contributor_surname": "Shin",
"orcid": null
},
{
"affiliation": [
{
"short_name": null,
"address": "Seoul, SK",
"full_name": "Sungkyunkwan University",
"webpage": "http://www.skku.edu/eng_home/index.jsp"
}
],
"contributor_name": "Trung",
"contributor_surname": "Thanh Thach",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2014-11-03",
"storage_temperature": null,
"cell_temperature": 22.0,
"exposure_time": 60.0,
"number_of_frames": 5,
"wavelength": 1.907,
"sample_detector_distance": 1.4,
"concentration_min": 1.15,
"concentration_max": 4.6,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.201,
"s_max": 2.003,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBN2_fit1_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBN2_fit1_model1.pdb",
"model_mw": 17.11,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 86
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBN2_fit1_model2_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBN2_fit1_model2.pdb",
"model_mw": 16.96,
"bead_radius": 1.9,
"log": null,
"symmetry": "",
"comment": "",
"user": 86
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBN2_fit1_fixed_fit_img.png",
"software": null,
"chi_square_value": 2.443312,
"p_value": 0.0007,
"fit_residual_plot": null,
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBN2_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "Note: The displayed results show a merged data set derived from a concentration series. Data were normalised to protein concentration and the high angle data from highest concentration and low angle data from lowest concentration were merged to generate final SAXS profile. Because of the flexibility of linear-diubiquitin molecule, ensemble optimisation method, EOM, was performed. The models shown above are two diubiquitin examples from the final EOM output. All EOM models, the radius of gyration distribution and maximum particle dimension distribution can be found in the full entry zip archive.",
"experiment_description": null,
"tags": [],
"intensity_unit": null,
"experimental_mw": 19.3,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 414.8,
"pddf_i0_error": null,
"guinier_i0": 414.0,
"guinier_i0_error": null,
"pddf_rg": 2.1,
"pddf_rg_error": 0.03,
"guinier_rg": 2.08,
"guinier_rg_error": 0.04,
"pddf_dmax": 6.6,
"pddf_dmax_error": null,
"porod_volume": 20.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 47,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDBN2_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-08-28T15:27:39.950868+02:00",
"bragg_peak": []
} View the complete manifest.json source {
"code": "SASDBN2",
"status": "success",
"started_at": "2026-08-11T13:42:13.768395+00:00",
"finished_at": "2026-08-11T13:42:22.280149+00:00",
"source_last_modified": "2020-08-28T15:27:39.950868+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBN2/",
"path": "/data/saxsdb/sasbdb/entries/n2/sasdbn2/source/summary.json",
"size": 8144,
"sha256": "2443af9e08549b2ff06fcc8eb05a10cbd8d92730d5bffe1989dae3a98dc1b501"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDBN2.dat",
"path": "/data/saxsdb/sasbdb/entries/n2/sasdbn2/source/SASDBN2.dat",
"size": 9223,
"sha256": "3a7eaae925af0dff7640585bbda1abb2c4b8ea41abd5a495a0d609edb6861a8e",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDBN2.out",
"path": "/data/saxsdb/sasbdb/entries/n2/sasdbn2/source/SASDBN2.out",
"size": 22245,
"sha256": "34a10a0f35dcb58aa09148e3d05280c76ed181e27e72baa61bf33cd79d1949e7",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBN2.sascif",
"path": "/data/saxsdb/sasbdb/entries/n2/sasdbn2/source/SASDBN2.sascif",
"size": 247677,
"sha256": "fd769e6340b8c4a37aba837ca7a08c7eb695e5bb0a441cffa4becb05a9882cd4",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDBN2.zip",
"path": "/data/saxsdb/sasbdb/entries/n2/sasdbn2/source/SASDBN2.zip",
"size": 135649,
"sha256": "e6c46e5cfbbdd0c4d56c3cd8e27d89d4702da2cc079077ca7c4f5f1c40b0076a",
"role": "full_entry_zip",
"zip_member_count": 8,
"zip_validation": "central_directory_readable"
}
]
} 
