Nucleolysin TIA-1 isoform p40 in complex with ACUCCUUUUU RNA

{
  "code": "SASDBN6",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "TIA-1 RRM23 binding and recognition of target oligonucleotides.",
    "publication": {
      "title": "TIA-1 RRM23 binding and recognition of target oligonucleotides.",
      "author_list": "Waris S, García-Mauriño SM, Sivakumaran A, Beckham SA, Loughlin FE, Gorospe M, Díaz-Moreno I, Wilce MCJ, Wilce JA",
      "journal": "Nucleic Acids Res",
      "doi": "10.1093/nar/gkx102",
      "pmid": "28184449",
      "published_date": "2017 May 5"
    },
    "status": "released",
    "submitted_date": "2016-09-22",
    "released_date": "2017-03-28"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBN6.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBN6.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBN6_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBN6_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBN6_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBN6_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBN6.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "Australian  Synchrotron",
      "city": "Melbourne",
      "country": "Australia",
      "beamline_name": "SAXS/WAXS",
      "beam_geometry": "Point",
      "type_of_source": "X-ray synchrotron",
      "point_source": true,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Nucleolysin TIA-1 isoform p40",
          "short_name": "TIA-1",
          "sequence": "ENLYFQGAMGNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGK",
          "organism": "Homo sapiens",
          "uniprot_code": "P31483",
          "uniprot_range_first": 93,
          "uniprot_range_last": 274,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAA\nAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTE\nDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTN\nWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQI\nMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQI\nGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGV\nQPPQGQNGSMLPNQPSGYRVAGYETQ",
          "mw": 21.325,
          "total_mw": 21.325,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "RNA (ACUCCUUUUU)",
          "short_name": null,
          "sequence": "ACUCCUUUUU",
          "organism": null,
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "RNA",
          "uniprot_sequence": null,
          "mw": 0.999,
          "total_mw": 0.999,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM HEPES, 100 mM NaCl, 3% v/v glycerol",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Nucleolysin TIA-1 isoform p40 in complex with ACUCCUUUUU RNA",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Melbourne, Australia",
            "full_name": "Monash University",
            "webpage": "http://www.monash.edu/"
          }
        ],
        "contributor_name": "Matthew",
        "contributor_surname": "Wilce",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-05-27",
    "storage_temperature": 15.0,
    "cell_temperature": 15.0,
    "exposure_time": 1.0,
    "number_of_frames": 30,
    "wavelength": 0.1033,
    "sample_detector_distance": 1.6,
    "concentration_min": null,
    "concentration_max": 2.5,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.224,
    "s_max": 3.004,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "GNOM 4.6",
  "i0_calibration_standard": null,
  "description": "TIA-1 RRM23 + CU-rich RNA",
  "experiment_description": "Synchrotron SAXS data from solutions of Nucleolysin TIA-1 isoform p40 in complex with RNA (ACUCCUUUUU) in 20 mM HEPES, 100mM NaCl, 3% v/v glycerol, pH 7 were collected on the SAXS/WAXS beam line at the Australian Synchrotron (Melbourne, Australia) using a Pilatus 1M detector at a sample-detector distance of 1.6 m and at a wavelength of λ = 0.1033 nm (I(s) vs s, where s = 4π sin θ/λ and 2θ is the scattering angle). The data were collected as 30 successive 1 second frames and were normalized to the intensity of the transmitted beam and radially averaged. The radially-averaged scattering of the solvent-blank was subtracted to produce the results displayed in this entry that shows the scattering profile from a sample at 2.5 mg/ml maintained at 15°C during the SAXS measurements.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 23.7,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.0556,
  "pddf_i0_error": null,
  "guinier_i0": 0.056,
  "guinier_i0_error": null,
  "pddf_rg": 2.15,
  "pddf_rg_error": null,
  "guinier_rg": 2.17,
  "guinier_rg_error": null,
  "pddf_dmax": 6.6,
  "pddf_dmax_error": null,
  "porod_volume": 29.8,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 82,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDBN6_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2020-07-22T10:39:57.780614+02:00",
  "bragg_peak": []
}

{
  "code": "SASDBN6",
  "status": "success",
  "started_at": "2026-08-11T16:40:48.977950+00:00",
  "finished_at": "2026-08-11T16:40:56.864203+00:00",
  "source_last_modified": "2020-07-22T10:39:57.780614+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBN6/",
      "path": "/data/saxsdb/sasbdb/entries/n6/sasdbn6/source/summary.json",
      "size": 7220,
      "sha256": "ef65b60af78e9a10c74dc3198066cb13a9d4e7a3da8e540b77e22c7d3bcac0d4"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDBN6.dat",
      "path": "/data/saxsdb/sasbdb/entries/n6/sasdbn6/source/SASDBN6.dat",
      "size": 32441,
      "sha256": "689f6de459b2274fcb6a3a2ac0886005f776ebe0137b2f15f2cd4f76bbcf08b5",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDBN6.out",
      "path": "/data/saxsdb/sasbdb/entries/n6/sasdbn6/source/SASDBN6.out",
      "size": 74892,
      "sha256": "412fba15ce178355855e03379ac78bd83f1fb6bc11444bf582823e7d94c4b7b2",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBN6.sascif",
      "path": "/data/saxsdb/sasbdb/entries/n6/sasdbn6/source/SASDBN6.sascif",
      "size": 89006,
      "sha256": "1822bfc947b4f87284ebd05c16b21de97b990b338030f9e645c180a773bcd422",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDBN6.zip",
      "path": "/data/saxsdb/sasbdb/entries/n6/sasdbn6/source/SASDBN6.zip",
      "size": 26897,
      "sha256": "f24dc6db1b320ba66ece665b19a5c5046424567d692f7ee4d9e1c34428c1faba",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}