The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDBP9",
"status": "Published",
"type_of_curve": "Extrapolated to infinite dilution",
"angular_unit": "1/nm",
"project": {
"title": "Disease Variants of FGFR3 Reveal Molecular Basis for the Recognition and Additional Roles for Cdc37 in Hsp90 Chaperone System.",
"publication": {
"title": "Disease Variants of FGFR3 Reveal Molecular Basis for the Recognition and Additional Roles for Cdc37 in Hsp90 Chaperone System.",
"author_list": "Bunney TD, Inglis AJ, Sanfelice D, Farrell B, Kerr CJ, Thompson GS, Masson GR, Thiyagarajan N, Svergun DI, Williams RL, Breeze AL, Katan M",
"journal": "Structure",
"doi": "10.1016/j.str.2018.01.016",
"pmid": "29478821",
"published_date": "2018 Mar 6"
},
"status": "released",
"submitted_date": "2017-01-18",
"released_date": "2018-03-20"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBP9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBP9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBP9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBP9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBP9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBP9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBP9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Hsp90 co-chaperone Cdc37",
"short_name": "CDC37",
"sequence": "MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK\r\nVAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLS\r\nKDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVH\r\nLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK\r\nIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYES\r\nLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPG\r\nDPLLEAVPKTGDEKDGSV",
"organism": "Homo sapiens",
"uniprot_code": "Q16543",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK\nVAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLS\nKDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVH\nLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK\nIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYES\nLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPG\nDPLLEAVPKTGDEKDVSV",
"mw": 44.426,
"total_mw": 44.426,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "25 mM Tris.Cl, 150 mM NaCl, 5% (v/v) glycerol, 1 mM TCEP",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Human Hsp90 co-chaperone Cdc37 protein (CD37)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Chris",
"contributor_surname": "Kerr",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-07-10",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.045,
"number_of_frames": 20,
"wavelength": 0.124,
"sample_detector_distance": 3.1,
"concentration_min": 1.1,
"concentration_max": 4.2,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.025,
"s_max": 5.031,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBP9_fit1_model1_img.png",
"software": "CORAL",
"pdb_link": [
{
"pdb_code": "1us7",
"ext_code": "1US7",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "mix",
"software_version": "ATSAS2.7.2",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBP9_fit1_model1.pdb",
"model_mw": 79.77,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/CDCFGF.log",
"symmetry": "",
"comment": "",
"user": 55
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBP9_fit1_fit_img.png",
"software": "CORAL",
"chi_square_value": 1.88,
"p_value": 0.0,
"fit_residual_plot": "SASDBP9_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBP9_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/CDCFGF.log",
"software_version": "ATSAS 2.7.",
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBP9_fit2_model1_img.png",
"software": "MONSA",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "ATSAS2.7.2",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBP9_fit2_model1.pdb",
"model_mw": null,
"bead_radius": 3.0,
"log": "https://www.sasbdb.org/media/log_files/CDCFGF_lbhOSg0.log",
"symmetry": "P1",
"comment": "",
"user": 55
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBP9_fit2_fit_img.png",
"software": "MONSA",
"chi_square_value": 1.635,
"p_value": 0.0,
"fit_residual_plot": "SASDBP9_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBP9_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/CDCFGF_bjHwmU7.log",
"software_version": "ATSAS2.7.2",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "GNOM5 - trunk r8992",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of human Hsp90 co-chaperone Cdc37 protein (CD37) in 25 mM Tris-HCl, 150 mM NaCl, 5% (v/v) glycerol, 1 mM TCEP, pH 8, were collected on the P12 beam line at the PETRA III storage ring (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3.1 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 1.1 and 4.2 mg/ml were measured at 20°C. 20 successive 0.045 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration. The low angle data collected at lower concentrations were extrapolated to infinite dilution and merged with the higher concentration data to yield the final composite scattering curve.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 49.1,
"experimental_mw_error": null,
"guinier_i0_mw": 49.1,
"guinier_i0_mw_error": 5.0,
"porod_mw": 52.0,
"porod_mw_error": null,
"pddf_i0": 6042.0,
"pddf_i0_error": 18.03,
"guinier_i0": 5968.74,
"guinier_i0_error": 17.13,
"pddf_rg": 4.19,
"pddf_rg_error": 0.02,
"guinier_rg": 3.99,
"guinier_rg_error": 0.59,
"pddf_dmax": 15.53,
"pddf_dmax_error": 3.0,
"porod_volume": 106.46,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 25,
"guinier_point_last": 110,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDBP9_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}
