Ankyrin repeat domains from human Tankyrase-2 (489-649)

{
  "code": "SASDBT2",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Hybrid Structural Analysis of the Arp2/3 Regulator Arpin Identifies Its Acidic Tail as a Primary Binding Epitope.",
    "publication": {
      "title": "Hybrid Structural Analysis of the Arp2/3 Regulator Arpin Identifies Its Acidic Tail as a Primary Binding Epitope.",
      "author_list": "Fetics S, Thureau A, Campanacci V, Aumont-Nicaise M, Dang I, Gautreau A, Pérez J, Cherfils J",
      "journal": "Structure",
      "doi": "10.1016/j.str.2015.12.001",
      "pmid": "26774128",
      "published_date": "2016 Feb 2"
    },
    "status": "released",
    "submitted_date": "2015-12-03",
    "released_date": "2016-07-03"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBT2.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBT2.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBT2_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBT2_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBT2_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBT2_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBT2.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "CCD",
        "name": "AVIEX PCCD170170",
        "resolution": null
      },
      "name": "SOLEIL",
      "city": "Saint-Aubin",
      "country": "France",
      "beamline_name": "SWING",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Ankyrin repeat domains from Tankyrase 2",
          "short_name": "Tankyrase-2(489-649)",
          "sequence": "GNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAAL",
          "organism": "Homo sapiens",
          "uniprot_code": "Q9H2K2",
          "uniprot_range_first": 489,
          "uniprot_range_last": 649,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKST\nPLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNAR\nDNWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDE\nLLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAK\nDKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYG\nADPTLLNCHNKSAIDLAPTPQLKERLAYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKH\nPQTHETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVV\nKHEAKVNALDNLGQTSLHRAAYCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQL\nLQEGISLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVS\nVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAA\nAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLAR\nVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAA\nSYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQT\nPLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATADALSSGPSSPSSLSAASS\nLDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEHLMDIFEREQIT\nLDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSP\nDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEEN\nHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTG\nCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYV\nIYRGEQAYPEYLITYQIMRPEGMVDG",
          "mw": 17.565,
          "total_mw": 17.565,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM HEPES 100mM NaCl 1mM TCEP",
        "concentration_unit": "mM",
        "comment": null,
        "additive": "100mM NaCl, 1mM TCEP",
        "concentration": 50.0,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Ankyrin repeat domains from human Tankyrase-2 (489-649)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "Soleil",
            "address": "Saint-Aubin, France",
            "full_name": "Soleil Synchrotron",
            "webpage": "http://www.synchrotron-soleil.fr/"
          }
        ],
        "contributor_name": "Aurélien",
        "contributor_surname": "Thureau",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2014-12-04",
    "storage_temperature": 15.0,
    "cell_temperature": null,
    "exposure_time": 1.5,
    "number_of_frames": null,
    "wavelength": 0.1,
    "sample_detector_distance": 1.82,
    "concentration_min": null,
    "concentration_max": null,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.062,
    "s_max": 6.083,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "X-ray synchrotron radiation scattering data from solutions of the Ankyrin repeat domains from human Tankyrase-2 (amino acids 489-649) in 50mM HEPES, pH 7.5, 100mM NaCl, 1mM TCEP were collected at 15 C on the SWING Beamline, Synchrotron Soleil, Gif Sur Yvette, France using a PCCD170170 Aviex detector. These data are derived from size-exclusion chromatography-SAXS. Note: The original SAXS data where the momentum transfer s in inverse Angstroms (s = 4π sin θ/λ, where 2θ is the scattering angle) is included in the zip file associated with this entry.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 17.1,
  "experimental_mw_error": null,
  "guinier_i0_mw": 17.1,
  "guinier_i0_mw_error": null,
  "porod_mw": 15.0,
  "porod_mw_error": null,
  "pddf_i0": 0.0444,
  "pddf_i0_error": 2e-05,
  "guinier_i0": 0.044,
  "guinier_i0_error": 3e-05,
  "pddf_rg": 1.84,
  "pddf_rg_error": 0.001,
  "guinier_rg": 1.77,
  "guinier_rg_error": 0.01,
  "pddf_dmax": 6.25,
  "pddf_dmax_error": null,
  "porod_volume": 23.6,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 23,
  "guinier_point_last": 111,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDBT2_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDBT2",
  "status": "success",
  "started_at": "2026-08-11T13:45:31.486347+00:00",
  "finished_at": "2026-08-11T13:45:42.030827+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBT2/",
      "path": "/data/saxsdb/sasbdb/entries/t2/sasdbt2/source/summary.json",
      "size": 7229,
      "sha256": "69ce7d9dbb34cfacf508a07b0facdf8cba5140d47f7cc938b8d615d4b075f2d5"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDBT2.dat",
      "path": "/data/saxsdb/sasbdb/entries/t2/sasdbt2/source/SASDBT2.dat",
      "size": 49539,
      "sha256": "165b624e0609aca78d21975eb1c644b3a28069c4648ef65a409b57aaf781b993",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDBT2.out",
      "path": "/data/saxsdb/sasbdb/entries/t2/sasdbt2/source/SASDBT2.out",
      "size": 85793,
      "sha256": "c0436747c6c386d1fb8549edb6a51b1e225794c3bb6f817ff16ec0dac8a3e1e7",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBT2.sascif",
      "path": "/data/saxsdb/sasbdb/entries/t2/sasdbt2/source/SASDBT2.sascif",
      "size": 114555,
      "sha256": "992e6b4fa9d642e90455571a668593ed02e46367674ff464d3dbe5274b6d5bae",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDBT2.zip",
      "path": "/data/saxsdb/sasbdb/entries/t2/sasdbt2/source/SASDBT2.zip",
      "size": 61286,
      "sha256": "e5b7cd7fcd37d74b40978bbdf9c4cecf67bed0a6c25dda341cadd7bb9ef010eb",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}