Human Arpin (isoform 1)

{
  "code": "SASDBU2",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Hybrid Structural Analysis of the Arp2/3 Regulator Arpin Identifies Its Acidic Tail as a Primary Binding Epitope.",
    "publication": {
      "title": "Hybrid Structural Analysis of the Arp2/3 Regulator Arpin Identifies Its Acidic Tail as a Primary Binding Epitope.",
      "author_list": "Fetics S, Thureau A, Campanacci V, Aumont-Nicaise M, Dang I, Gautreau A, Pérez J, Cherfils J",
      "journal": "Structure",
      "doi": "10.1016/j.str.2015.12.001",
      "pmid": "26774128",
      "published_date": "2016 Feb 2"
    },
    "status": "released",
    "submitted_date": "2015-12-03",
    "released_date": "2016-07-03"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBU2.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBU2.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBU2_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBU2_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBU2_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBU2_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBU2.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "CCD",
        "name": "AVIEX PCCD170170",
        "resolution": null
      },
      "name": "SOLEIL",
      "city": "Saint-Aubin",
      "country": "France",
      "beamline_name": "SWING",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Human Arpin",
          "short_name": "Human Arpin",
          "sequence": "GSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIHRRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDD",
          "organism": "Homo sapiens",
          "uniprot_code": "Q7Z6K5",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYY\nVLYIRPSHIHRRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLV\nNKPELLALTESLTPDHTVAFWMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTV\nTKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDD",
          "mw": 24.869,
          "total_mw": 24.869,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM HEPES 100mM NaCl 1mM TCEP",
        "concentration_unit": "mM",
        "comment": null,
        "additive": "100mM NaCl, 1mM TCEP",
        "concentration": 50.0,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Human Arpin (isoform 1)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "Soleil",
            "address": "Saint-Aubin, France",
            "full_name": "Soleil Synchrotron",
            "webpage": "http://www.synchrotron-soleil.fr/"
          }
        ],
        "contributor_name": "Aurélien",
        "contributor_surname": "Thureau",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2014-12-04",
    "storage_temperature": 15.0,
    "cell_temperature": 15.0,
    "exposure_time": 1.5,
    "number_of_frames": null,
    "wavelength": 0.1,
    "sample_detector_distance": 1.82,
    "concentration_min": null,
    "concentration_max": null,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.062,
    "s_max": 6.083,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": "Due to high concentration at the elution peak, the HPLC UV detector was saturated and the concentrations of the sample was consequently underestimated. In this case, the molecular mass is overestimated when assessing this parameter from I(0) and concentration.",
  "experiment_description": "X-ray synchrotron radiation scattering data from solutions of human arpin in 50mM HEPES, pH 7.5, 100mM NaCl, 1mM TCEP were collected at 15 C on the SWING Beamline, Synchrotron Soleil, Gif Sur Yvette, France using a PCCD170170 Aviex detector. These data are derived from size-exclusion chromatography-SAXS. Note: The original SAXS data where the momentum transfer s in inverse Angstroms (s = 4π sin θ/λ, where 2θ is the scattering angle) is included in the zip file associated with this entry. ",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 27.4,
  "experimental_mw_error": null,
  "guinier_i0_mw": 27.4,
  "guinier_i0_mw_error": null,
  "porod_mw": 27.8,
  "porod_mw_error": null,
  "pddf_i0": 0.05,
  "pddf_i0_error": null,
  "guinier_i0": 0.05,
  "guinier_i0_error": null,
  "pddf_rg": 2.77,
  "pddf_rg_error": 0.05,
  "guinier_rg": 2.6,
  "guinier_rg_error": null,
  "pddf_dmax": 13.2,
  "pddf_dmax_error": null,
  "porod_volume": 47.23,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 10,
  "guinier_point_last": 82,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDBU2_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDBU2",
  "status": "success",
  "started_at": "2026-08-11T13:46:13.945123+00:00",
  "finished_at": "2026-08-11T13:46:24.236509+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBU2/",
      "path": "/data/saxsdb/sasbdb/entries/u2/sasdbu2/source/summary.json",
      "size": 6446,
      "sha256": "fdd4530473c647e075c2b333efcc21ea8a0de70fa3568b21f20fa5a63696ced6"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDBU2.dat",
      "path": "/data/saxsdb/sasbdb/entries/u2/sasdbu2/source/SASDBU2.dat",
      "size": 49538,
      "sha256": "1f7ffeaa7e94ebcf35b59013f06f45ad8a5788d52a513ae231ed4b0e3cae1268",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDBU2.out",
      "path": "/data/saxsdb/sasbdb/entries/u2/sasdbu2/source/SASDBU2.out",
      "size": 74617,
      "sha256": "799e390ae41163eafc92246c0cdd6171888b654bc7a7b98ee69be466472c3145",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBU2.sascif",
      "path": "/data/saxsdb/sasbdb/entries/u2/sasdbu2/source/SASDBU2.sascif",
      "size": 109258,
      "sha256": "1da8842eb42e6a7d20c162fa3b49bfc103bea73701629521a83f1bc009852159",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDBU2.zip",
      "path": "/data/saxsdb/sasbdb/entries/u2/sasdbu2/source/SASDBU2.zip",
      "size": 58986,
      "sha256": "8ebdd65c7e25e6be0f80127316e71c26dbd4a8932be053de71d847bd9fd828d4",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}