The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDBY9",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Molecular Architecture of the Major Membrane Ring Component of the Nuclear Pore Complex.",
"publication": {
"title": "Molecular Architecture of the Major Membrane Ring Component of the Nuclear Pore Complex.",
"author_list": "Upla P, Kim SJ, Sampathkumar P, Dutta K, Cahill SM, Chemmama IE, Williams R, Bonanno JB, Rice WJ, Stokes DL, Cowburn D, Almo SC, Sali A, Rout MP, Fernandez-Martinez J",
"journal": "Structure",
"doi": "10.1016/j.str.2017.01.006",
"pmid": "28162953",
"published_date": "2017 Mar 7"
},
"status": "released",
"submitted_date": "2017-01-23",
"released_date": "2017-02-16"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBY9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBY9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBY9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBY9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBY9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBY9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBY9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Rayonix MX225-HE",
"resolution": null
},
"name": "Stanford Synchrotron Radiation Lightsource (SSRL)",
"city": "Menlo Park, CA",
"country": "USA",
"beamline_name": "BL4-2",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Nucleoporin POM152",
"short_name": null,
"sequence": "GKSNVLVTMPVAPTMEVKSFPILDQCVGQVGLNFELSFTGAPPYYYNTKIYKLENGERKLYDAKRYTSEGTRNRFSYSPPKEGNYEIVFDTVSNKLFTEPIKLEPVKEYTFKTSMRVKPSASLKLHHDLKLCLGDHSSVPVALKGQGPFTLTYDIIETFSSKRKTFEIKEIKTNEYVIKTPVFTTGGDYILSLVSIKDSTGCVVGLSQPDAKIQVRRDEGHHHHHH",
"organism": "Saccharomyces cerevisiae",
"uniprot_code": "P39685",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MEHRYNVFNDTPRGNHWMGSSVSGSPRPSYSSRPNVNTTRRFQYSDDEPAEKIRPLRSRS\nFKSTESNISDEKSRISERDSKDRYINGDKKVDIYSLPLISTDVLEISKQRTFAVILFLII\nQCYKIYDLVILKSGLPLSGLLFKNYRFNFISKYFIIDSFFLYVLPSFNIPRLTFKPWVVY\nLQILAMLLLNIFISSDHEFVLISLIMTTWRKLYTKELSVTGSAINHHRIFDSSAHFKGAL\nTIKILPENTAMFNPLHESYCLPMDTNLFKINSIDVPIRINSTEEIEYIELEYRDLYTNSV\nELRSLSKKDFKIIDNPKSFLKKDQSVLKSHSNDFEEGSTIRYLAVTLQDIGFYQIKKIVD\nSKKLNLKIHQSHLVVPYCPIASITGTGSNDRCIGDSDNVSFEIQGVPPMKLAYSKIVNGQ\nTFSYVDSSLQPEYFESPLQSSKSKQSFTQGELNDLKWGRNQPVNINLDSSITQDGKFAYK\nIDKITDGLGNVVDFTSLPEELKKRYDLSYNFNVHEVPRAALEERFDPKSPTKRSIAIVFE\nEIKNWISDIPYVISLSYTDAQDKSKKIMNVTTDSLTKVLQADLPGSYNLEYIESKFCPGE\nIVGKSNVLVTMPVAPTMEVKSFPILDQCVGQVGLNFELSFTGAPPYYYNTKIYKLENGER\nKLYDAKRYTSEGTRNRFSYSPPKEGNYEIVFDTVSNKLFTEPIKLEPVKEYTFKTSMRVK\nPSASLKLHHDLKLCLGDHSSVPVALKGQGPFTLTYDIIETFSSKRKTFEIKEIKTNEYVI\nKTPVFTTGGDYILSLVSIKDSTGCVVGLSQPDAKIQVRRDIPSAAFNFFEPIKEAKIKHG\nSVTEIPLKLSGEGPFTVKFKHMDYDGNIVKEFENKFQNSYKPALKVSKEGLYQLVDIRDS\nSCQGNVIYRNSLYKVSFLEKPKFAIQDNHHITKVTENLFSKEEVCQGMEGTVDLALFGSP\nPFILEYDLMAPNGHISTKKIQVATKYASLKLPNQIPGEYITTIKAIFDGNYGESDIHFRE\nHQSELIIKQTVHPIPDVAFADGGKTLRACAANVDQISFLEPINLKFLQGESPFSITFSVY\nHESTSRTDQYTIDNIDSENFSFEKLYEGMKLGNHAITIDSVVDANGCVNSLISGPRNQIL\nVSITDAPKIHILDPSTEYCVGDYVAYQLNGVAPFMIKYEFNGIPLKSKERSSQFVRLASE\nPGIISITSLQDSSSQCIVDFTNPKLKSEFDDLSLNIHPIPSVTVSQGNYVTEDIREGDQA\nEVIFSFEGTPPFSLTYVRTEETDGKHGKRRSQVVETHKVTDIYSHEYKVITSLQGTYEAI\nEITDAYCFAKNDLFFNN",
"mw": 25.552,
"total_mw": 25.552,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "10mM HEPES, 150mM NaCl, 10%(v/v) glycerol, 5mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Immunoglobulin domains 3,4 of Nucleoporin Pom152 (Pom152 Ig-3,4: amino acids 603-820)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "UCSF",
"address": "San Francisco, CA, USA",
"full_name": "University of California, San Francisco (UCSF)",
"webpage": "https://www.ucsf.edu/"
}
],
"contributor_name": "Seung Joong",
"contributor_surname": "Kim",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-04-12",
"storage_temperature": 15.0,
"cell_temperature": 15.0,
"exposure_time": 1.0,
"number_of_frames": 20,
"wavelength": 0.098,
"sample_detector_distance": 1.7,
"concentration_min": 0.5,
"concentration_max": 11.9,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.096,
"s_max": 3.616,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBY9_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBY9_fit1_model1.pdb",
"model_mw": 22.245,
"bead_radius": 2.25,
"log": null,
"symmetry": "",
"comment": "",
"user": 197
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBY9_fit1_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 2.017,
"p_value": 3e-06,
"fit_residual_plot": "SASDBY9_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBY9_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/27005_25.log",
"software_version": "5.3",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "gnom 4.5a",
"i0_calibration_standard": null,
"description": "Guinier Rg and I(0) were calculated using AutoRg. The experimental MW was estimated using SAXSMOW.",
"experiment_description": "Synchrotron SAXS data from solutions of Immunoglobulin domains 3,4 of Nucleoporin Pom152 (Pom152 Ig-3,4: amino acids 603-820) in 10mM HEPES, 150mM NaCl, 10%(v/v) glycerol, 5mM DTT, pH 7.5 were collected on the BL4-2 beam line at the Stanford Synchrotron Radiation Lightsource (SSRL) (Stanford, CA, USA) using a Rayonix MX225-HE detector at a sample-detector distance of 1.7 m and at a wavelength of λ = 0.098 nm (I(s) vs s, where = 4πsinθ/λ and 2θ is the scattering angle). Solute concentrations ranging between 0.5 and 11.9 mg/ml were measured at 15°C. 20 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the different curves were scaled for protein concentration.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 25.9,
"experimental_mw_error": null,
"guinier_i0_mw": 25.2,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 1550.0,
"pddf_i0_error": 1.71,
"guinier_i0": 1553.37,
"guinier_i0_error": 2.97,
"pddf_rg": 2.976,
"pddf_rg_error": 0.005,
"guinier_rg": 2.95,
"guinier_rg_error": 0.11,
"pddf_dmax": 10.45,
"pddf_dmax_error": null,
"porod_volume": 27.97,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 3,
"guinier_point_last": 23,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDBY9_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDBY9",
"status": "success",
"started_at": "2026-08-11T16:42:15.022387+00:00",
"finished_at": "2026-08-11T16:42:24.308155+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBY9/",
"path": "/data/saxsdb/sasbdb/entries/y9/sasdby9/source/summary.json",
"size": 8985,
"sha256": "462e7b07a72fe77515dce0206e146a2db5390f1e8cba015eb0bc93e8189b3df7"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDBY9.dat",
"path": "/data/saxsdb/sasbdb/entries/y9/sasdby9/source/SASDBY9.dat",
"size": 16598,
"sha256": "df75d280cba42a589ca8bb9c64c77e8f485ce3720ae164afc4d5fe39986b5da2",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDBY9.out",
"path": "/data/saxsdb/sasbdb/entries/y9/sasdby9/source/SASDBY9.out",
"size": 33611,
"sha256": "e9829a54c92f1eeb28aa3b8c16c8140b922d1bf9dfbb98e5f5efdd51d931f6e2",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBY9.sascif",
"path": "/data/saxsdb/sasbdb/entries/y9/sasdby9/source/SASDBY9.sascif",
"size": 136956,
"sha256": "60b979ee2fd54874bf7147e19c18dc62c2ea079d2da399e589975792a24cb2b2",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDBY9.zip",
"path": "/data/saxsdb/sasbdb/entries/y9/sasdby9/source/SASDBY9.zip",
"size": 27808,
"sha256": "9e1ffa70267a521b0d92a059cec9f4c85887483d5d626e87664979df2b3600e0",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
