The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDBZ2",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "X-Ray Solution Scattering Study of Four Escherichia coli Enzymes Involved in Stationary-Phase Metabolism.",
"publication": {
"title": "X-Ray Solution Scattering Study of Four Escherichia coli Enzymes Involved in Stationary-Phase Metabolism.",
"author_list": "Dadinova LA, Shtykova EV, Konarev PV, Rodina EV, Snalina NE, Vorobyeva NN, Kurilova SA, Nazarova TI, Jeffries CM, Svergun DI",
"journal": "PLoS One",
"doi": "10.1371/journal.pone.0156105",
"pmid": "27227414",
"published_date": "2016"
},
"status": "released",
"submitted_date": "2015-12-14",
"released_date": "2016-07-01"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBZ2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBZ2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBZ2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBZ2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBZ2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBZ2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBZ2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Class I fructose-1,6-bisphosphate aldolase (FbaB) from E. coli",
"short_name": "FbaB",
"sequence": "MTDIAQLLGKDADNLLQHCCMTIPSDQLYLPGHDYVDRVMIDNNRPPAVLRNMQTLYNTG\r\nRLAGTGYLSILPVDQGVEHSAGASFAANPLYFDPKNIVELAIEAGCNCVASTYGVLASVS\r\nRRYAHRIPFLVKLNHNETLSYPNTYDQTLYASVEQAFNMGAVAVGATIYFGSEESRRQIE\r\nEISAAFERAHELGMVTVLWAYLRNSAFKKDGVDYHVSADLTGQANHLAATIGADIVKQKM\r\nAENNGGYKAINYGYTDDRVYSKLTSENPIDLVRYQLANCYMGRAGLINSGGAAGGETDLS\r\nDAVRTAVINKRAGGMGLILGRKAFKKSMADGVKLINAVQDVYLDSKITIA",
"organism": "Escherichia coli",
"uniprot_code": "A0A0K4BP99",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "decamer",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 38.056,
"total_mw": 380.557,
"number_molecules": 10,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Tris 10 mM NaCl",
"concentration_unit": "mM",
"comment": null,
"additive": "10 mM NaCl",
"concentration": 50.0,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Class I fructose-1,6-bisphosphate aldolase (FbaB) from E. coli",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "MSU",
"address": "Moscow, Russia",
"full_name": "Lomonosov Moscow State University",
"webpage": "http://www.msu.ru"
}
],
"contributor_name": "Liubov",
"contributor_surname": "Dadinova",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2013-06-30",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 0.05,
"number_of_frames": 20,
"wavelength": 0.12,
"sample_detector_distance": 3.1,
"concentration_min": 1.4,
"concentration_max": 10.8,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.085,
"s_max": 3.234,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBZ2_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBZ2_fit1_model1.pdb",
"model_mw": 158.25,
"bead_radius": 2.8,
"log": "https://www.sasbdb.org/media/log_files/2.log",
"symmetry": "P52",
"comment": "",
"user": 94
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBZ2_fit1_fit_img.png",
"software": null,
"chi_square_value": 1.23,
"p_value": 0.00021,
"fit_residual_plot": "SASDBZ2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBZ2_fit1.fir",
"fit_log": null,
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBZ2_fit2_model1_img.png",
"software": "CORAL",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBZ2_fit2_model1.pdb",
"model_mw": 378.8,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/fba200.log",
"symmetry": "P52",
"comment": "",
"user": 94
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBZ2_fit2_fit_img.png",
"software": null,
"chi_square_value": 1.81,
"p_value": 0.0,
"fit_residual_plot": "SASDBZ2_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBZ2_fit2.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "The models displayed above are, from top to bottom: 1) An individual DAMMIN dummy atom model and; 2) CORAL rigid body model with the associated CRYSOL fit to the data. All of the individual DAMMIN models and associated fits can be found in the zip archive for this entry along with the CORAL modelling results.",
"experiment_description": "Synchrotron SAXS data from solutions of Class I fructose-1,6-bisphosphate aldolase (FbaB) from E. coli in 50 mM Tris pH 7.5 were collected on the P12 beam line of Petra-III (Hamburg, Germany) using a Pilatus 2M detector (I(s) vs s; s = 4π sin θ/λ, where 2θ is the scattering angle and λ=0.124 nm). Different solute concentrations in the range 2.6-13.30 mg/ml were measured using an exposure time of 1 s (recorded as 20 x 0.050 s frames). The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering from the matched solvent-blank was subtracted. The data presented here are from a single concentration scattering curve (9.3 mg/ml).",
"tags": [],
"intensity_unit": null,
"experimental_mw": 340.0,
"experimental_mw_error": null,
"guinier_i0_mw": 340.0,
"guinier_i0_mw_error": null,
"porod_mw": 302.0,
"porod_mw_error": null,
"pddf_i0": 16670.0,
"pddf_i0_error": 18.0,
"guinier_i0": 16826.0,
"guinier_i0_error": 25.0,
"pddf_rg": 4.34,
"pddf_rg_error": 0.04,
"guinier_rg": 4.43,
"guinier_rg_error": 0.02,
"pddf_dmax": 12.73,
"pddf_dmax_error": null,
"porod_volume": 484.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 2,
"guinier_point_last": 81,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDBZ2_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDBZ2",
"status": "success",
"started_at": "2026-08-11T13:49:42.824397+00:00",
"finished_at": "2026-08-11T13:50:03.716442+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBZ2/",
"path": "/data/saxsdb/sasbdb/entries/z2/sasdbz2/source/summary.json",
"size": 8776,
"sha256": "d0c30abb4c212f72aabecdb15796a9941dc97aa6b3f0c397a462c9db25290e71"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDBZ2.dat",
"path": "/data/saxsdb/sasbdb/entries/z2/sasdbz2/source/SASDBZ2.dat",
"size": 55489,
"sha256": "4436f89920bdad1cf52ec3053b51d4e153e4c68df2c46641048cec2136282c92",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDBZ2.out",
"path": "/data/saxsdb/sasbdb/entries/z2/sasdbz2/source/SASDBZ2.out",
"size": 99135,
"sha256": "252205d09ce3e4252f2b50913e5b1662ffd82f033583c492ecdbbdbbac4f44dd",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBZ2.sascif",
"path": "/data/saxsdb/sasbdb/entries/z2/sasdbz2/source/SASDBZ2.sascif",
"size": 2872716,
"sha256": "945ee99eda29ee1c482188724798323582c16355764f64792bb53be929b65d54",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDBZ2.zip",
"path": "/data/saxsdb/sasbdb/entries/z2/sasdbz2/source/SASDBZ2.zip",
"size": 2333090,
"sha256": "878fce599374a852e1f8810982e9c0d655f7f37e2db822c5f72d818fa0a32065",
"role": "full_entry_zip",
"zip_member_count": 9,
"zip_validation": "central_directory_readable"
}
]
}
