The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDBZ5",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Structure of the NPr:EIN<sup>Ntr</sup> Complex: Mechanism for Specificity in Paralogous Phosphotransferase Systems.",
"publication": {
"title": "Structure of the NPr:EIN<sup>Ntr</sup> Complex: Mechanism for Specificity in Paralogous Phosphotransferase Systems.",
"author_list": "Strickland M, Stanley AM, Wang G, Botos I, Schwieters CD, Buchanan SK, Peterkofsky A, Tjandra N",
"journal": "Structure",
"doi": "10.1016/j.str.2016.10.007",
"pmid": "27839951",
"published_date": "2016 Dec 6"
},
"status": "released",
"submitted_date": "2016-08-29",
"released_date": "2016-11-11"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDBZ5.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDBZ5.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBZ5_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBZ5_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDBZ5_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDBZ5_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBZ5.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 100K",
"resolution": 172.0
},
"name": "NIDDK, NIH",
"city": "Bethesda, MD",
"country": "USA",
"beamline_name": "Rigaku BioSAXS-1000",
"beam_geometry": "",
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Phosphocarrier protein NPr",
"short_name": "NPr",
"sequence": "MTVKQTVEITNKLGMHARPAMKLFELMQGFDAEVLLRNDEGTEAEANSVIALLMLDSAKG\r\nRQIEVEATGPQEEEALAAVIALFNS",
"organism": "Escherichia coli",
"uniprot_code": "P0A9N0",
"uniprot_range_first": 1,
"uniprot_range_last": 85,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MTVKQTVEITNKLGMHARPAMKLFELMQGFDAEVLLRNDEGTEAEANSVIALLMLDSAKG\nRQIEVEATGPQEEEALAAVIALFNSGFDED",
"mw": 9.25,
"total_mw": 9.25,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Phosphoenolpyruvate-protein phosphotransferase PtsP",
"short_name": "Enzyme I-Ntr",
"sequence": "RIRALPAAPGV\r\nAIAEGWQDATLPLMEQVYQASTLDPALERERLTGALEEAANEFRRYSKRFAAGAQKETAA\r\nIFDLYSHLLSDTRLRRELFAEVDKGSVAEWAVKTVIEKFAEQFAALSDNYLKERAGDLRA\r\nLGQRLLFHLDDANQGPNAWPERFILVADELSATTLAELPQDRLVGVVVRDGAANSHAAIM\r\nVRALGIPTVMGADIQPSVLHRRTLIVDGYRGELLVDPEPVLLQEYQRLISEEIELSRLAE\r\nDDVN",
"organism": "Escherichia coli",
"uniprot_code": "P37177",
"uniprot_range_first": 170,
"uniprot_range_last": 424,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MLTRLREIVEKVASAPRLNEALNILVTDICLAMDTEVCSVYLADHDRRCYYLMATRGLKK\nPRGRTVTLAFDEGIVGLVGRLAEPINLADAQKHPSFKYIPSVKEERFRAFLGVPIIQRRQ\nLLGVLVVQQRELRQYDESEESFLVTLATQMAAILSQSQLTALFGQYRQTRIRALPAAPGV\nAIAEGWQDATLPLMEQVYQASTLDPALERERLTGALEEAANEFRRYSKRFAAGAQKETAA\nIFDLYSHLLSDTRLRRELFAEVDKGSVAEWAVKTVIEKFAEQFAALSDNYLKERAGDLRA\nLGQRLLFHLDDANQGPNAWPERFILVADELSATTLAELPQDRLVGVVVRDGAANSHAAIM\nVRALGIPTVMGADIQPSVLHRRTLIVDGYRGELLVDPEPVLLQEYQRLISEEIELSRLAE\nDDVNLPAQLKSGERIKVMLNAGLSPEHEEKLGSRIDGIGLYRTEIPFMLQSGFPSEEEQV\nAQYQGMLQMFNDKPVTLRTLDVGADKQLPYMPISEENPCLGWRGIRITLDQPEIFLIQVR\nAMLRANAATGNLNILLPMVTSLDEVDEARRLIERAGREVEEMIGYEIPKPRIGIMLEVPS\nMVFMLPHLAKRVDFISVGTNDLTQYILAVDRNNTRVANIYDSLHPAMLRALAMIAREAEI\nHGIDLRLCGEMAGDPMCVAILIGLGYRHLSMNGRSVARAKYLLRRIDYAEAENLAQRSLE\nAQLATEVRHQVAAFMERRGMGGLIRGGL",
"mw": 28.35,
"total_mw": 28.35,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "10 mM Tris 150 mM NaCl 0.5 mM EDTA",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Enzyme I-Ntr (residues 170-424) in complex with NPr (residues 1-85)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "NIH",
"address": "Bethesda, Maryland, USA",
"full_name": "National Institutes of Health, Bethesda, MD",
"webpage": "https://www.nih.gov/"
}
],
"contributor_name": "Madeleine",
"contributor_surname": "Strickland",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-01-30",
"storage_temperature": 4.0,
"cell_temperature": 27.0,
"exposure_time": 1800.0,
"number_of_frames": 8,
"wavelength": 0.154,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": 3.76,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.181,
"s_max": 6.797,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDBZ5_fit1_model1_img.png",
"software": "PDB (Protein Data Bank)",
"pdb_link": [
{
"pdb_code": "5t1o",
"ext_code": "5t1o",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": "2.8.3",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDBZ5_fit1_model1.pdb",
"model_mw": 37.52,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/5t1o-100.log",
"symmetry": "",
"comment": "Fig. 5J",
"user": 154
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDBZ5_fit1_fit_img.png",
"software": null,
"chi_square_value": 1.25,
"p_value": 7.8e-05,
"fit_residual_plot": "SASDBZ5_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDBZ5_fit1.fit",
"fit_log": null,
"software_version": null,
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "ATSAS Primus",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of Enzyme I-Ntr (residues 170-424) complexed with NPr (residues 1-85) in 10 mM Tris 150 mM NaCl 0.5 mM EDTA, pH 7.5 were collected using an in house X-ray source at the NIDDK, National Institutes of Health, Bethesda, MD using a wavelength of λ = 0.154 nm (I(s) vs s, where s = 4π sin θ/λ, and 2θ is the scattering angle). One solute concentration of 3.76 mg/ml was measured. Eight successive 1800 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged and the scattering of the solvent-blank was subtracted. The low angle data collected were obtained from a single concentration scattering curve.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 37.6,
"experimental_mw_error": null,
"guinier_i0_mw": 22.0,
"guinier_i0_mw_error": null,
"porod_mw": 30.6,
"porod_mw_error": null,
"pddf_i0": 2.87,
"pddf_i0_error": null,
"guinier_i0": 2.83,
"guinier_i0_error": null,
"pddf_rg": 2.373,
"pddf_rg_error": null,
"guinier_rg": 2.319,
"guinier_rg_error": null,
"pddf_dmax": 8.16,
"pddf_dmax_error": null,
"porod_volume": 52.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 7,
"guinier_point_last": 25,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDBZ5_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDBZ5",
"status": "success",
"started_at": "2026-08-11T14:59:29.698725+00:00",
"finished_at": "2026-08-11T14:59:38.007132+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDBZ5/",
"path": "/data/saxsdb/sasbdb/entries/z5/sasdbz5/source/summary.json",
"size": 9161,
"sha256": "a72833d96937fa2e48cdf7033ce3089585f8948779b6b4f2a4ab6deba9eedb93"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDBZ5.dat",
"path": "/data/saxsdb/sasbdb/entries/z5/sasdbz5/source/SASDBZ5.dat",
"size": 21499,
"sha256": "cc21b73bc3bf9666ee4563cbf4e87b093bec07d3e5dfcc63297da6245790c75c",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDBZ5.out",
"path": "/data/saxsdb/sasbdb/entries/z5/sasdbz5/source/SASDBZ5.out",
"size": 24743,
"sha256": "8d7a0f76c00354eed14726d8f766cb6173e0b892d0fd23395787ad398fe1d8fb",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDBZ5.sascif",
"path": "/data/saxsdb/sasbdb/entries/z5/sasdbz5/source/SASDBZ5.sascif",
"size": 319977,
"sha256": "48f85e3ce049c7b239840460d2fa02580ed74810998aa5a5255defe4a1c01034",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDBZ5.zip",
"path": "/data/saxsdb/sasbdb/entries/z5/sasdbz5/source/SASDBZ5.zip",
"size": 65257,
"sha256": "30c4e1693df2a5a96a3403db115db582df684dd32b25ec26991f401cbf247755",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
