Proline utilization A from Bradyrhizobium diazoefficiens (formerly Bradyrhizobium japonicum) R51E mutant 4.7 mg/mL

{
  "code": "SASDC24",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Biophysical investigation of type A PutAs reveals a conserved core oligomeric structure.",
    "publication": {
      "title": "Biophysical investigation of type A PutAs reveals a conserved core oligomeric structure.",
      "author_list": "Korasick DA, Singh H, Pemberton TA, Luo M, Dhatwalia R, Tanner JJ",
      "journal": "FEBS J",
      "doi": "10.1111/febs.14165",
      "pmid": "28710792",
      "published_date": "2017 Sep"
    },
    "status": "released",
    "submitted_date": "2017-05-19",
    "released_date": "2017-07-17"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC24.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC24.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC24_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC24_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC24_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC24_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC24.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus3 X 2M",
        "resolution": 172.0
      },
      "name": "Advanced Light Source (ALS)",
      "city": "Berkeley, CA",
      "country": "USA",
      "beamline_name": "12.3.1 (SIBYLS)",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Proline dehydrogenase",
          "short_name": "BjPutA R51E",
          "sequence": "GHMPNIPPPFTAPYAPDDAEIAARLLPASHLSPPQEARIHRTATRLIEAIRKEDDRLGGVEDMLREFALSTKEGLALMVL\r\nAEALLRVPDARTADQFIEDKLGEGDFIHHETKSTAFLVNASAWALGLSARVIQPGETPDGTIGRLVKRLGAPAVRTATRQ\r\nAMRLMGNHFVLGETIEQALERGKPRSGQKTRYSFDMLGEGARTAADARRYFDAYASAIETIGKAAGNHALPDRPGISVKL\r\nSALHPRFEAISRARVMVELVPQLLDLAQRAKAHDLNFTVDAEEADRLELSLDVIAATLADPSLKGWDGFGLAIQAYQKRA\r\nSAVIDYVDALARAHDRKLMVRLVKGAYWDTEIKRAQERGLDGYPVFTRKAMTDLNYVACASKLLALRPRIFPQFATHNAL\r\nTVATVLEMAEGSSGFEFQRLHGMGEALYEQLAKDHADIAYRTYAPVGSHRDLLAYLVRRLLENGANSSFVAQAADYRVPV\r\nPALLQRPADAIVRPQAAAHPRIPLPCDLFAPERRNSRGVEFGARTALDQLLTDVKAETGDLKPIADATPDQAHAAVAAAR\r\nAGFAGWSRTPAGIRAAALEQAAHLLESRSAHFIALLQREGGKTLDDALSELREAADFCRYYAAQGRKLFGSETAMPGPTG\r\nESNALTMRGRGVFVAISPWNFPLAIFLGQVTAALMAGNSVVAKPAEQTPRIAREAVALLHEAGIPKSALYLVTGDGRIGA\r\nALTAHPDIAGVVFTGSTEVARSINRALAAKDGPIVPLIAETGGINAMIADATALPEQVADDVVTSAFRSAGQRCSALRLL\r\nFVQEDVADRMIEMVAGAARELKIGDPSDVATHVGPVIDVEAKQRLDAHIARMKTEARLHFAGPAPEGCFVAPHIFELTEA\r\nGQLTEEVFGPILHVVRYRPENLERVLRAIERTGYGLTLGVHSRIDDSIEAIIDRVQVGNIYVNRNMIGAVVGVQPFGGNG\r\nLSGTGPKAGGPHYLARFATEQTVTINTAAAGGNAALLAGEE",
          "organism": "Bradyrhizobium diazoefficiens",
          "uniprot_code": "Q89E26",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MPNIPPPFTAPYAPDDAEIAARLLPASHLSPPQEARIHRTATRLIEAIRKRDDRLGGVED\nMLREFALSTKEGLALMVLAEALLRVPDARTADQFIEDKLGEGDFIHHETKSTAFLVNASA\nWALGLSARVIQPGETPDGTIGRLVKRLGAPAVRTATRQAMRLMGNHFVLGETIEQALERG\nKPRSGQKTRYSFDMLGEGARTAADARRYFDAYASAIETIGKAAGNHALPDRPGISVKLSA\nLHPRFEAISRARVMVELVPQLLDLAQRAKAHDLNFTVDAEEADRLELSLDVIAATLADPS\nLKGWDGFGLAIQAYQKRASAVIDYVDALARAHDRKLMVRLVKGAYWDTEIKRAQERGLDG\nYPVFTRKAMTDLNYVACASKLLALRPRIFPQFATHNALTVATVLEMAEGSSGFEFQRLHG\nMGEALYEQLAKDHADIAYRTYAPVGSHRDLLAYLVRRLLENGANSSFVAQAADYRVPVPA\nLLQRPADAIVRPQAAAHPRIPLPCDLFAPERRNSRGVEFGARTALDQLLTDVKAETGDLK\nPIADATPDQAHAAVAAARAGFAGWSRTPAGIRAAALEQAAHLLESRSAHFIALLQREGGK\nTLDDALSELREAADFCRYYAAQGRKLFGSETAMPGPTGESNALTMRGRGVFVAISPWNFP\nLAIFLGQVTAALMAGNSVVAKPAEQTPRIAREAVALLHEAGIPKSALYLVTGDGRIGAAL\nTAHPDIAGVVFTGSTEVARSINRALAAKDGPIVPLIAETGGINAMIADATALPEQVADDV\nVTSAFRSAGQRCSALRLLFVQEDVADRMIEMVAGAARELKIGDPSDVATHVGPVIDVEAK\nQRLDAHIARMKTEARLHFAGPAPEGCFVAPHIFELTEAGQLTEEVFGPILHVVRYRPENL\nERVLRAIERTGYGLTLGVHSRIDDSIEAIIDRVQVGNIYVNRNMIGAVVGVQPFGGNGLS\nGTGPKAGGPHYLARFATEQTVTINTAAAGGNAALLAGEE",
          "mw": 107.531,
          "total_mw": 215.062,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM Tris (pH 7.8), 50 mM NaCl, 0.5 mM Tris(2-carboxyethyl)phosphine, and 5% (v/v) glycerol",
        "concentration_unit": null,
        "comment": "BjPutA buffer",
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.8,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Proline utilization A from Bradyrhizobium diazoefficiens (formerly Bradyrhizobium japonicum) R51E mutant 4.7 mg/mL",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "Mizzou",
            "address": "Columbia, MO, USA",
            "full_name": "University of Missouri-Columbia",
            "webpage": "http://missouri.edu/"
          }
        ],
        "contributor_name": "John",
        "contributor_surname": "Tanner",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-12-16",
    "storage_temperature": null,
    "cell_temperature": null,
    "exposure_time": null,
    "number_of_frames": null,
    "wavelength": null,
    "sample_detector_distance": null,
    "concentration_min": null,
    "concentration_max": 4.7,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.131,
    "s_max": 3.244,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of Proline utilization A from Bradyrhizobium diazoefficiens (formerly Bradyrhizobium japonicum) R51E mutant in 50 mM Tris, 50 mM NaCl, 0.5 mM Tris(2-carboxyethyl)phosphine, and 5% (v/v) glycerol, pH 7.8 were collected on the 12.3.1 (SIBYLS) beam line at the Advanced Light Source (ALS; Berkeley, CA, USA) using a Pilatus3 X 2M detector (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle). One solute concentration of 4.7 mg/ml was measured. The data were normalized to the intensity of the transmitted beam and radially averaged. The  radially averaged scattering of the solvent-blank was subtracted.  X-ray wavelength, unknown; Exposure time, unknown; Sample-To-Detector distance, unknown.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 216.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 227.0,
  "pddf_i0_error": 0.6,
  "guinier_i0": 232.34,
  "guinier_i0_error": 3.21,
  "pddf_rg": 4.5,
  "pddf_rg_error": 0.01,
  "guinier_rg": 4.5,
  "guinier_rg_error": 0.06,
  "pddf_dmax": 13.9,
  "pddf_dmax_error": null,
  "porod_volume": 283.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 27,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDC24_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2026-05-18T10:06:39.081163+02:00",
  "bragg_peak": []
}

{
  "code": "SASDC24",
  "status": "success",
  "started_at": "2026-08-11T14:12:07.256292+00:00",
  "finished_at": "2026-08-11T14:12:14.752930+00:00",
  "source_last_modified": "2026-05-18T10:06:39.081163+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDC24/",
      "path": "/data/saxsdb/sasbdb/entries/24/sasdc24/source/summary.json",
      "size": 8157,
      "sha256": "3dcda28af18a7cd967158c5c0234729c3f13b7dfaa0e0f4cf65ba99af66f8fa5"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDC24.dat",
      "path": "/data/saxsdb/sasbdb/entries/24/sasdc24/source/SASDC24.dat",
      "size": 23085,
      "sha256": "129a96a3ed7cf0c2d0ef7a4cb807a1d55ee8d74de2fdbf99eab9eebd3f15f269",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDC24.out",
      "path": "/data/saxsdb/sasbdb/entries/24/sasdc24/source/SASDC24.out",
      "size": 47867,
      "sha256": "4296c4bc7f7824faa3409c5acb4b51571c7765d3904a250349565da7fcec3e8f",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC24.sascif",
      "path": "/data/saxsdb/sasbdb/entries/24/sasdc24/source/SASDC24.sascif",
      "size": 61860,
      "sha256": "4da5e1a9ea8132e9f03e13661e6b7edfbe4e106ccb29c33ce2355f963ac1561a",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDC24.zip",
      "path": "/data/saxsdb/sasbdb/entries/24/sasdc24/source/SASDC24.zip",
      "size": 19679,
      "sha256": "4ac1db408bafd3be62dc4747536772103468dab1fce01ce28fbe0c6ccf182d04",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}