The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDC25",
"status": "Published",
"type_of_curve": "Other",
"angular_unit": "1/A",
"project": {
"title": "Analysis of the natively unstructured RNA/protein-recognition core in the Escherichia coli RNA degradosome and its interactions with regulatory RNA/Hfq complexes.",
"publication": {
"title": "Analysis of the natively unstructured RNA/protein-recognition core in the Escherichia coli RNA degradosome and its interactions with regulatory RNA/Hfq complexes.",
"author_list": "Bruce HA, Du D, Matak-Vinkovic D, Bandyra KJ, Broadhurst RW, Martin E, Sobott F, Shkumatov AV, Luisi BF",
"journal": "Nucleic Acids Res",
"doi": "10.1093/nar/gkx1083",
"pmid": "29136196",
"published_date": "2018 Jan 9"
},
"status": "released",
"submitted_date": "2017-06-07",
"released_date": "2017-11-09"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDC25.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDC25.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC25_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC25_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDC25_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDC25_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDC25.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "CCD",
"name": "AVIEX PCCD170170",
"resolution": null
},
"name": "SOLEIL",
"city": "Saint-Aubin",
"country": "France",
"beamline_name": "SWING",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "RNase E 603-850",
"short_name": "RNase E 603-850",
"sequence": "ERQQDRRKPRQNNRRDRNERRDTRSERTEGSDNREENRRNRRQAQQQTAETRESRQQA\r\nEVTEKARTADEQQAPRRERSRRRNDDKRQAQQEAKALNVEEQSVQETEQEERVRPVQPRR\r\nKQRQLNQKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPAPRTELVKVPLPVVAQTAPEQ\r\nQEENNADNRDNGGMPRRSRRSPRHLRVSGQRRRRYRDERYPTQSPMPLTVACASPELASG\r\nKVWIRYPIVRHHHHHH",
"organism": "Escherichia coli",
"uniprot_code": "Q46977",
"uniprot_range_first": 603,
"uniprot_range_last": 850,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "LSYMLPKLHEEAMALPSEEEFAERKRPEQPALATFAMPDVPPAPTPAEPAAPVVAPAPKA\nAPATPAAPAQPGLLSRFFGALKALFSGGEETKPTEQPAPKAEAKPERQQDRRKPRQNNRR\nDRNERRDTRSERTEGSDNREENRRNRRQAQQQTAETRESRQQAEVTEKARTADEQQAPRR\nERSRRRNDDKRQAQQEAKALNVEEQSVQETEQEERVRPVQPRRKQRQLNQKVRYEQSVAE\nEAVVAPVVEETVAAEPIVQEAPAPRTELVKVPLPVVAQTAPEQQEENNADNRDNGGMPRR\nSRRSPRHLRVSGQRRRRYRDERYPTQSPMPLTVACASPELASGKVWIRYPIVRPQDVQVE\nEQREQEEVHVQPMVTEVPVAAAIEPVVSAPVVEEVAGVVEAPVQVAEPQPEVVETTHPEV\nIAAAVTEQPQVITESDVAVAQEVAEQAEPVVEPQEETADIEEVVETAEVVVAEPEVVAQP\nAAPVVAEVAAEVETVAAVEPEVTVEHNHATAPMTRAPAPEYVPEAPRHSDWQRPTFA",
"mw": 30.127,
"total_mw": 30.127,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "ATP-dependent RNA helicase RhlB",
"short_name": "RhlB",
"sequence": "MSKTHLTEQKFSDFALHPKVVEALEKKGFHNCTPIQALALPLTLAGRDVAGQAQTGTGKT\r\nMAFLTSTFHYLLSHPAIADRKVNQPRALIMAPTRELAVQIHADAEPLAEATGLKLGLAYG\r\nGDGYDKQLKVLESGVDILIGTTGRLIDYAKQNHINLGAIQVVVLDEADRMYDLGFIKDIR\r\nWLFRRMPPANQRLNMLFSATLSYRVRELAFEQMNNAEYIEVEPEQKTGHRIKEELFYPSN\r\nEEKMRLLQTLIEEEWPDRAIIFANTKHRCEEIWGHLAADGHRVGLLTGDVAQKKRLRILD\r\nEFTRGDLDILVATDVAARGLHIPAVTHVFNYDLPDDCEDYVHRIGRTGRAGASGHSISLA\r\nCEEYALNLPAIETYIGHSIPVSKYNPDALMTDLPKPLRLTRPRTGNGPRRTGAPRNRRRS\r\nG",
"organism": "Escherichia coli",
"uniprot_code": "W8ZZD4",
"uniprot_range_first": 1,
"uniprot_range_last": 421,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSKTHLTEQKFSDFALHPKVVEALEKKGFHNCTPIQALALPLTLAGRDVAGQAQTGTGKT\nMAFLTSTFHYLLSHPAIADRKVNQPRALIMAPTRELAVQIHADAEPLAEATGLKLGLAYG\nGDGYDKQLKVLESGVDILIGTTGRLIDYAKQNHINLGAIQVVVLDEADRMYDLGFIKDIR\nWLFRRMPPANQRLNMLFSATLSYRVRELAFEQMNNAEYIEVEPEQKTGHRIKEELFYPSN\nEEKMRLLQTLIEEEWPDRAIIFANTKHRCEEIWGHLAADGHRVGLLTGDVAQKKRLRILD\nEFTRGDLDILVATDVAARGLHIPAVTHVFNYDLPDDCEDYVHRIGRTGRAGASGHSISLA\nCEEYALNLPAIETYIGHSIPVSKYNPDALMTDLPKPLRLTRPRTGNGPRRTGAPRNRRRS\nG",
"mw": 47.125,
"total_mw": 47.125,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Enolase",
"short_name": "Enolase",
"sequence": "MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL\r\nGKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAK\r\nAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVK\r\nEAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKD\r\nITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDG\r\nFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAK\r\nDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKA\r\nPYNGRKEIKGQA",
"organism": "Escherichia coli",
"uniprot_code": "A1AEW7",
"uniprot_range_first": 1,
"uniprot_range_last": 432,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL\nGKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAK\nAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVK\nEAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKD\nITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDG\nFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAK\nDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKA\nPYNGRKEIKGQA",
"mw": 45.654,
"total_mw": 91.308,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Tris HCl, 100 mM NaCl, 100 mM KCl, 10 mM MgCl2, 10 mM DTT and 5 % glycerol (v/v)",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "RNase E 603-850/ATP-dependent RNA helicase (RhlB)/enolase ternary complex",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "VUB",
"address": "Pleinlaan 2 1050 Brussel ",
"full_name": "Vrije Universiteit Brussel",
"webpage": "http://www.vub.ac.be/"
}
],
"contributor_name": "Alexander",
"contributor_surname": "Shkumatov",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2014-07-16",
"storage_temperature": 15.0,
"cell_temperature": 15.0,
"exposure_time": 1.5,
"number_of_frames": 250,
"wavelength": 0.1022,
"sample_detector_distance": 1.79,
"concentration_min": null,
"concentration_max": 9.1,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.062,
"s_max": 6.127,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDC25_fit1_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "2.3",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDC25_fit1_model1.pdb",
"model_mw": null,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/TG7.log",
"symmetry": "P1",
"comment": "Best fitting model out of 10 independent reconstructions",
"user": 104
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDC25_fit1_fit_img.png",
"software": "GASBOR",
"chi_square_value": 4.97,
"p_value": 1e-06,
"fit_residual_plot": "SASDC25_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDC25_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/TG7.log",
"software_version": "2.3i r9450",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "v5.0 (r8972)",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data (I(s) vs s, where s = 4πsinθ/λ and 2θ is the scattering angle) were collected on the SWING beam line at Soleil synchrotron (Gif-sur-Yvette, France). Samples were stored at 288 K in a robotic sample chamber and automatically loaded (9.1 mg/ml) onto a Superdex 200 Increase 3.2/300 gel-filtration column (GE Healthcare) equilibrated with 50 mM Tris HCl pH 7.5, 100 mM NaCl, 100 mM KCl, 10 mM MgCl2, 10 mM DTT and 5 % glycerol (v/v), at a flow rate of 150 μl min-1 by a HPLC (High performance liquid chromatography) instrument (Agilent), directly before elution into the sample detection chamber, where a monochromatic beam illuminated the sample with a wavelength of 0.1022 nm as it flowed through. The sample-detector distance was 1.79 m. During the elution, 250 scattering measurements were taken with 1.5-s time-frames and 0.5-s dead-time between frames. The in-house program FOXTROT (David and Pérez, 2009) was used to normalize and radially average the data. After averaging 20-30 buffer frames in PRIMUS (Konarev et al., 2003), the program DATASW (Shkumatov and Strelkov, 2015) was employed to (i) subtract the buffer average from each sample frame and (ii) calculation of I(0) Rg and MW. Frames corresponding to the peak where Rg was stable were used for averaging.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 208.5,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 165.0,
"porod_mw_error": null,
"pddf_i0": 0.19,
"pddf_i0_error": 0.01,
"guinier_i0": 0.185772,
"guinier_i0_error": 0.01,
"pddf_rg": 6.971,
"pddf_rg_error": 0.019,
"guinier_rg": 6.39,
"guinier_rg_error": 0.128,
"pddf_dmax": 30.5,
"pddf_dmax_error": 1.0,
"porod_volume": 280.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 4,
"guinier_point_last": 19,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDC25_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}
